commit
stringlengths
40
40
old_file
stringlengths
4
118
new_file
stringlengths
4
118
old_contents
stringlengths
0
2.94k
new_contents
stringlengths
1
4.43k
subject
stringlengths
15
444
message
stringlengths
16
3.45k
lang
stringclasses
1 value
license
stringclasses
13 values
repos
stringlengths
5
43.2k
prompt
stringlengths
17
4.58k
response
stringlengths
1
4.43k
prompt_tagged
stringlengths
58
4.62k
response_tagged
stringlengths
1
4.43k
text
stringlengths
132
7.29k
text_tagged
stringlengths
173
7.33k
03d71787ef04627b620cbf234a0413b136b66ce1
main.py
main.py
#!/usr/bin/env python import asyncio import logging import sys import discord from discord.ext.commands import when_mentioned_or import yaml from bot import BeattieBot try: import uvloop except ImportError: pass else: asyncio.set_event_loop_policy(uvloop.EventLoopPolicy()) with open('config.yaml') as file: config = yaml.load(file) self_bot = 'self' in sys.argv if self_bot: token = config['self'] bot = BeattieBot('b>', self_bot=True) else: token = config['token'] bot = BeattieBot(when_mentioned_or('>')) for extension in ('default', 'rpg', 'eddb', 'repl', 'wolfram', 'nsfw'): try: bot.load_extension(extension) except Exception as e: print(f'Failed to load extension {extension}\n{type(e).__name__}: {e}') if not self_bot: logger = logging.getLogger('discord') logger.setLevel(logging.INFO) handler = logging.FileHandler( filename='discord.log', encoding='utf-8', mode='w') handler.setFormatter( logging.Formatter('%(asctime)s:%(levelname)s:%(name)s: %(message)s')) logger.addHandler(handler) bot.logger = logger bot.run(token, bot=not self_bot)
#!/usr/bin/env python import asyncio import logging import sys import discord from discord.ext.commands import when_mentioned_or import yaml from bot import BeattieBot try: import uvloop except ImportError: pass else: asyncio.set_event_loop_policy(uvloop.EventLoopPolicy()) with open('config.yaml') as file: config = yaml.load(file) self_bot = 'self' in sys.argv if self_bot: token = config['self'] bot = BeattieBot('b>', self_bot=True) else: token = config['token'] bot = BeattieBot(when_mentioned_or('>')) for extension in ('default', 'rpg', 'eddb', 'repl', 'wolfram', 'stats'): try: bot.load_extension(extension) except Exception as e: print(f'Failed to load extension {extension}\n{type(e).__name__}: {e}') if not self_bot: logger = logging.getLogger('discord') logger.setLevel(logging.INFO) handler = logging.FileHandler( filename='discord.log', encoding='utf-8', mode='w') handler.setFormatter( logging.Formatter('%(asctime)s:%(levelname)s:%(name)s: %(message)s')) logger.addHandler(handler) bot.logger = logger bot.run(token, bot=not self_bot)
Load stats on startup, don't load nsfw
Load stats on startup, don't load nsfw
Python
mit
BeatButton/beattie,BeatButton/beattie-bot
#!/usr/bin/env python import asyncio import logging import sys import discord from discord.ext.commands import when_mentioned_or import yaml from bot import BeattieBot try: import uvloop except ImportError: pass else: asyncio.set_event_loop_policy(uvloop.EventLoopPolicy()) with open('config.yaml') as file: config = yaml.load(file) self_bot = 'self' in sys.argv if self_bot: token = config['self'] bot = BeattieBot('b>', self_bot=True) else: token = config['token'] bot = BeattieBot(when_mentioned_or('>')) for extension in ('default', 'rpg', 'eddb', 'repl', 'wolfram', 'nsfw'): try: bot.load_extension(extension) except Exception as e: print(f'Failed to load extension {extension}\n{type(e).__name__}: {e}') if not self_bot: logger = logging.getLogger('discord') logger.setLevel(logging.INFO) handler = logging.FileHandler( filename='discord.log', encoding='utf-8', mode='w') handler.setFormatter( logging.Formatter('%(asctime)s:%(levelname)s:%(name)s: %(message)s')) logger.addHandler(handler) bot.logger = logger bot.run(token, bot=not self_bot) Load stats on startup, don't load nsfw
#!/usr/bin/env python import asyncio import logging import sys import discord from discord.ext.commands import when_mentioned_or import yaml from bot import BeattieBot try: import uvloop except ImportError: pass else: asyncio.set_event_loop_policy(uvloop.EventLoopPolicy()) with open('config.yaml') as file: config = yaml.load(file) self_bot = 'self' in sys.argv if self_bot: token = config['self'] bot = BeattieBot('b>', self_bot=True) else: token = config['token'] bot = BeattieBot(when_mentioned_or('>')) for extension in ('default', 'rpg', 'eddb', 'repl', 'wolfram', 'stats'): try: bot.load_extension(extension) except Exception as e: print(f'Failed to load extension {extension}\n{type(e).__name__}: {e}') if not self_bot: logger = logging.getLogger('discord') logger.setLevel(logging.INFO) handler = logging.FileHandler( filename='discord.log', encoding='utf-8', mode='w') handler.setFormatter( logging.Formatter('%(asctime)s:%(levelname)s:%(name)s: %(message)s')) logger.addHandler(handler) bot.logger = logger bot.run(token, bot=not self_bot)
<commit_before>#!/usr/bin/env python import asyncio import logging import sys import discord from discord.ext.commands import when_mentioned_or import yaml from bot import BeattieBot try: import uvloop except ImportError: pass else: asyncio.set_event_loop_policy(uvloop.EventLoopPolicy()) with open('config.yaml') as file: config = yaml.load(file) self_bot = 'self' in sys.argv if self_bot: token = config['self'] bot = BeattieBot('b>', self_bot=True) else: token = config['token'] bot = BeattieBot(when_mentioned_or('>')) for extension in ('default', 'rpg', 'eddb', 'repl', 'wolfram', 'nsfw'): try: bot.load_extension(extension) except Exception as e: print(f'Failed to load extension {extension}\n{type(e).__name__}: {e}') if not self_bot: logger = logging.getLogger('discord') logger.setLevel(logging.INFO) handler = logging.FileHandler( filename='discord.log', encoding='utf-8', mode='w') handler.setFormatter( logging.Formatter('%(asctime)s:%(levelname)s:%(name)s: %(message)s')) logger.addHandler(handler) bot.logger = logger bot.run(token, bot=not self_bot) <commit_msg>Load stats on startup, don't load nsfw<commit_after>
#!/usr/bin/env python import asyncio import logging import sys import discord from discord.ext.commands import when_mentioned_or import yaml from bot import BeattieBot try: import uvloop except ImportError: pass else: asyncio.set_event_loop_policy(uvloop.EventLoopPolicy()) with open('config.yaml') as file: config = yaml.load(file) self_bot = 'self' in sys.argv if self_bot: token = config['self'] bot = BeattieBot('b>', self_bot=True) else: token = config['token'] bot = BeattieBot(when_mentioned_or('>')) for extension in ('default', 'rpg', 'eddb', 'repl', 'wolfram', 'stats'): try: bot.load_extension(extension) except Exception as e: print(f'Failed to load extension {extension}\n{type(e).__name__}: {e}') if not self_bot: logger = logging.getLogger('discord') logger.setLevel(logging.INFO) handler = logging.FileHandler( filename='discord.log', encoding='utf-8', mode='w') handler.setFormatter( logging.Formatter('%(asctime)s:%(levelname)s:%(name)s: %(message)s')) logger.addHandler(handler) bot.logger = logger bot.run(token, bot=not self_bot)
#!/usr/bin/env python import asyncio import logging import sys import discord from discord.ext.commands import when_mentioned_or import yaml from bot import BeattieBot try: import uvloop except ImportError: pass else: asyncio.set_event_loop_policy(uvloop.EventLoopPolicy()) with open('config.yaml') as file: config = yaml.load(file) self_bot = 'self' in sys.argv if self_bot: token = config['self'] bot = BeattieBot('b>', self_bot=True) else: token = config['token'] bot = BeattieBot(when_mentioned_or('>')) for extension in ('default', 'rpg', 'eddb', 'repl', 'wolfram', 'nsfw'): try: bot.load_extension(extension) except Exception as e: print(f'Failed to load extension {extension}\n{type(e).__name__}: {e}') if not self_bot: logger = logging.getLogger('discord') logger.setLevel(logging.INFO) handler = logging.FileHandler( filename='discord.log', encoding='utf-8', mode='w') handler.setFormatter( logging.Formatter('%(asctime)s:%(levelname)s:%(name)s: %(message)s')) logger.addHandler(handler) bot.logger = logger bot.run(token, bot=not self_bot) Load stats on startup, don't load nsfw#!/usr/bin/env python import asyncio import logging import sys import discord from discord.ext.commands import when_mentioned_or import yaml from bot import BeattieBot try: import uvloop except ImportError: pass else: asyncio.set_event_loop_policy(uvloop.EventLoopPolicy()) with open('config.yaml') as file: config = yaml.load(file) self_bot = 'self' in sys.argv if self_bot: token = config['self'] bot = BeattieBot('b>', self_bot=True) else: token = config['token'] bot = BeattieBot(when_mentioned_or('>')) for extension in ('default', 'rpg', 'eddb', 'repl', 'wolfram', 'stats'): try: bot.load_extension(extension) except Exception as e: print(f'Failed to load extension {extension}\n{type(e).__name__}: {e}') if not self_bot: logger = logging.getLogger('discord') logger.setLevel(logging.INFO) handler = logging.FileHandler( filename='discord.log', encoding='utf-8', mode='w') handler.setFormatter( logging.Formatter('%(asctime)s:%(levelname)s:%(name)s: %(message)s')) logger.addHandler(handler) bot.logger = logger bot.run(token, bot=not self_bot)
<commit_before>#!/usr/bin/env python import asyncio import logging import sys import discord from discord.ext.commands import when_mentioned_or import yaml from bot import BeattieBot try: import uvloop except ImportError: pass else: asyncio.set_event_loop_policy(uvloop.EventLoopPolicy()) with open('config.yaml') as file: config = yaml.load(file) self_bot = 'self' in sys.argv if self_bot: token = config['self'] bot = BeattieBot('b>', self_bot=True) else: token = config['token'] bot = BeattieBot(when_mentioned_or('>')) for extension in ('default', 'rpg', 'eddb', 'repl', 'wolfram', 'nsfw'): try: bot.load_extension(extension) except Exception as e: print(f'Failed to load extension {extension}\n{type(e).__name__}: {e}') if not self_bot: logger = logging.getLogger('discord') logger.setLevel(logging.INFO) handler = logging.FileHandler( filename='discord.log', encoding='utf-8', mode='w') handler.setFormatter( logging.Formatter('%(asctime)s:%(levelname)s:%(name)s: %(message)s')) logger.addHandler(handler) bot.logger = logger bot.run(token, bot=not self_bot) <commit_msg>Load stats on startup, don't load nsfw<commit_after>#!/usr/bin/env python import asyncio import logging import sys import discord from discord.ext.commands import when_mentioned_or import yaml from bot import BeattieBot try: import uvloop except ImportError: pass else: asyncio.set_event_loop_policy(uvloop.EventLoopPolicy()) with open('config.yaml') as file: config = yaml.load(file) self_bot = 'self' in sys.argv if self_bot: token = config['self'] bot = BeattieBot('b>', self_bot=True) else: token = config['token'] bot = BeattieBot(when_mentioned_or('>')) for extension in ('default', 'rpg', 'eddb', 'repl', 'wolfram', 'stats'): try: bot.load_extension(extension) except Exception as e: print(f'Failed to load extension {extension}\n{type(e).__name__}: {e}') if not self_bot: logger = logging.getLogger('discord') logger.setLevel(logging.INFO) handler = logging.FileHandler( filename='discord.log', encoding='utf-8', mode='w') handler.setFormatter( logging.Formatter('%(asctime)s:%(levelname)s:%(name)s: %(message)s')) logger.addHandler(handler) bot.logger = logger bot.run(token, bot=not self_bot)
89fcf556d6b6086434ea961c19b770ffd3fdc7be
main.py
main.py
#!/usr/bin/env python """ This is the main file. The script finds the game window and sets up the coordinates for each block. The MIT License (MIT) (c) 2016 """ def main(): """ No inputs No outputs Starts up the gameregionfinder """ if __name__ == "__main__": main()
#!/usr/bin/env python """ This is the main file. The script finds the game window and sets up the coordinates for each block. The MIT License (MIT) (c) 2016 """ import pyautogui, logging, time logging.basicConfig(level=logging.DEBUG, format='%(asctime)s.%(msecs)03d: %(message)s', datefmt='%H:%M:%S') # logging.disable(logging.DEBUG) # uncomment to block debug log messages __author__ = "Alex Flores Escarcega" __copyright__ = "Copyright 2007, Alex Flores Escarcega" __credits__ = ["Alex Flores Escarcega"] __license__ = "MIT" __version__ = "1.0.1" __maintainer__ = "Alex Flores Escarcega" __email__ = "[email protected]" __status__ = "Development" def main(): """ No inputs No outputs Starts up the gameregionfinder """ if __name__ == "__main__": main()
Add imports, logging configs, and authorship info
Add imports, logging configs, and authorship info
Python
mit
hydrophilicsun/Automating-Minesweeper-
#!/usr/bin/env python """ This is the main file. The script finds the game window and sets up the coordinates for each block. The MIT License (MIT) (c) 2016 """ def main(): """ No inputs No outputs Starts up the gameregionfinder """ if __name__ == "__main__": main() Add imports, logging configs, and authorship info
#!/usr/bin/env python """ This is the main file. The script finds the game window and sets up the coordinates for each block. The MIT License (MIT) (c) 2016 """ import pyautogui, logging, time logging.basicConfig(level=logging.DEBUG, format='%(asctime)s.%(msecs)03d: %(message)s', datefmt='%H:%M:%S') # logging.disable(logging.DEBUG) # uncomment to block debug log messages __author__ = "Alex Flores Escarcega" __copyright__ = "Copyright 2007, Alex Flores Escarcega" __credits__ = ["Alex Flores Escarcega"] __license__ = "MIT" __version__ = "1.0.1" __maintainer__ = "Alex Flores Escarcega" __email__ = "[email protected]" __status__ = "Development" def main(): """ No inputs No outputs Starts up the gameregionfinder """ if __name__ == "__main__": main()
<commit_before>#!/usr/bin/env python """ This is the main file. The script finds the game window and sets up the coordinates for each block. The MIT License (MIT) (c) 2016 """ def main(): """ No inputs No outputs Starts up the gameregionfinder """ if __name__ == "__main__": main() <commit_msg>Add imports, logging configs, and authorship info<commit_after>
#!/usr/bin/env python """ This is the main file. The script finds the game window and sets up the coordinates for each block. The MIT License (MIT) (c) 2016 """ import pyautogui, logging, time logging.basicConfig(level=logging.DEBUG, format='%(asctime)s.%(msecs)03d: %(message)s', datefmt='%H:%M:%S') # logging.disable(logging.DEBUG) # uncomment to block debug log messages __author__ = "Alex Flores Escarcega" __copyright__ = "Copyright 2007, Alex Flores Escarcega" __credits__ = ["Alex Flores Escarcega"] __license__ = "MIT" __version__ = "1.0.1" __maintainer__ = "Alex Flores Escarcega" __email__ = "[email protected]" __status__ = "Development" def main(): """ No inputs No outputs Starts up the gameregionfinder """ if __name__ == "__main__": main()
#!/usr/bin/env python """ This is the main file. The script finds the game window and sets up the coordinates for each block. The MIT License (MIT) (c) 2016 """ def main(): """ No inputs No outputs Starts up the gameregionfinder """ if __name__ == "__main__": main() Add imports, logging configs, and authorship info#!/usr/bin/env python """ This is the main file. The script finds the game window and sets up the coordinates for each block. The MIT License (MIT) (c) 2016 """ import pyautogui, logging, time logging.basicConfig(level=logging.DEBUG, format='%(asctime)s.%(msecs)03d: %(message)s', datefmt='%H:%M:%S') # logging.disable(logging.DEBUG) # uncomment to block debug log messages __author__ = "Alex Flores Escarcega" __copyright__ = "Copyright 2007, Alex Flores Escarcega" __credits__ = ["Alex Flores Escarcega"] __license__ = "MIT" __version__ = "1.0.1" __maintainer__ = "Alex Flores Escarcega" __email__ = "[email protected]" __status__ = "Development" def main(): """ No inputs No outputs Starts up the gameregionfinder """ if __name__ == "__main__": main()
<commit_before>#!/usr/bin/env python """ This is the main file. The script finds the game window and sets up the coordinates for each block. The MIT License (MIT) (c) 2016 """ def main(): """ No inputs No outputs Starts up the gameregionfinder """ if __name__ == "__main__": main() <commit_msg>Add imports, logging configs, and authorship info<commit_after>#!/usr/bin/env python """ This is the main file. The script finds the game window and sets up the coordinates for each block. The MIT License (MIT) (c) 2016 """ import pyautogui, logging, time logging.basicConfig(level=logging.DEBUG, format='%(asctime)s.%(msecs)03d: %(message)s', datefmt='%H:%M:%S') # logging.disable(logging.DEBUG) # uncomment to block debug log messages __author__ = "Alex Flores Escarcega" __copyright__ = "Copyright 2007, Alex Flores Escarcega" __credits__ = ["Alex Flores Escarcega"] __license__ = "MIT" __version__ = "1.0.1" __maintainer__ = "Alex Flores Escarcega" __email__ = "[email protected]" __status__ = "Development" def main(): """ No inputs No outputs Starts up the gameregionfinder """ if __name__ == "__main__": main()
ff7b10fe2b32f6c6b988ac1094c494cb986dded4
tests/smolder_tests.py
tests/smolder_tests.py
#!/usr/bin/env python2 import smolder import nose import json import os from nose.tools import assert_raises from imp import reload THIS_DIR = os.path.dirname(os.path.realpath(__file__)) def test_noop_test(): assert smolder.noop_test() def test_github_status(): myfile = open(THIS_DIR + '/github_status.json') test_json = json.load(myfile) for test in test_json['tests']: smolder.http_test(test, 'status.github.com', False) reload(smolder) assert smolder.failed_tests == 0 def test_github_status_response_time_expect_fail(): myfile = open(THIS_DIR + '/harsh_github_status.json') test_json = json.load(myfile) for test in test_json['tests']: smolder.http_test(test, 'status.github.com', False) reload(smolder) assert smolder.failed_tests > 0 def test_tcp_test(): smolder.tcp_test('127.0.0.1', 22) #Are you running an ssh server? def test_fail_tcp_test(): assert_raises(Exception, smolder.tcp_test, '127.0.0.1', 4242)
#!/usr/bin/env python2 import smolder import json import os from nose.tools import assert_raises from imp import reload THIS_DIR = os.path.dirname(os.path.realpath(__file__)) def test_noop_test(): assert smolder.noop_test() def test_github_status(): myfile = open(THIS_DIR + '/github_status.json') test_json = json.load(myfile) for test in test_json['tests']: smolder.http_test(test, 'status.github.com', False) reload(smolder) assert smolder.failed_tests == 0 def test_github_status_response_time_expect_fail(): myfile = open(THIS_DIR + '/harsh_github_status.json') test_json = json.load(myfile) for test in test_json['tests']: smolder.http_test(test, 'status.github.com', False) reload(smolder) assert smolder.failed_tests > 0 def test_tcp_test(): smolder.tcp_test('127.0.0.1', 22) #Are you running an ssh server? def test_fail_tcp_test(): assert_raises(Exception, smolder.tcp_test, '127.0.0.1', 4242)
Clean up imports in smolder tests
Clean up imports in smolder tests
Python
bsd-3-clause
sky-shiny/smolder,sky-shiny/smolder
#!/usr/bin/env python2 import smolder import nose import json import os from nose.tools import assert_raises from imp import reload THIS_DIR = os.path.dirname(os.path.realpath(__file__)) def test_noop_test(): assert smolder.noop_test() def test_github_status(): myfile = open(THIS_DIR + '/github_status.json') test_json = json.load(myfile) for test in test_json['tests']: smolder.http_test(test, 'status.github.com', False) reload(smolder) assert smolder.failed_tests == 0 def test_github_status_response_time_expect_fail(): myfile = open(THIS_DIR + '/harsh_github_status.json') test_json = json.load(myfile) for test in test_json['tests']: smolder.http_test(test, 'status.github.com', False) reload(smolder) assert smolder.failed_tests > 0 def test_tcp_test(): smolder.tcp_test('127.0.0.1', 22) #Are you running an ssh server? def test_fail_tcp_test(): assert_raises(Exception, smolder.tcp_test, '127.0.0.1', 4242) Clean up imports in smolder tests
#!/usr/bin/env python2 import smolder import json import os from nose.tools import assert_raises from imp import reload THIS_DIR = os.path.dirname(os.path.realpath(__file__)) def test_noop_test(): assert smolder.noop_test() def test_github_status(): myfile = open(THIS_DIR + '/github_status.json') test_json = json.load(myfile) for test in test_json['tests']: smolder.http_test(test, 'status.github.com', False) reload(smolder) assert smolder.failed_tests == 0 def test_github_status_response_time_expect_fail(): myfile = open(THIS_DIR + '/harsh_github_status.json') test_json = json.load(myfile) for test in test_json['tests']: smolder.http_test(test, 'status.github.com', False) reload(smolder) assert smolder.failed_tests > 0 def test_tcp_test(): smolder.tcp_test('127.0.0.1', 22) #Are you running an ssh server? def test_fail_tcp_test(): assert_raises(Exception, smolder.tcp_test, '127.0.0.1', 4242)
<commit_before>#!/usr/bin/env python2 import smolder import nose import json import os from nose.tools import assert_raises from imp import reload THIS_DIR = os.path.dirname(os.path.realpath(__file__)) def test_noop_test(): assert smolder.noop_test() def test_github_status(): myfile = open(THIS_DIR + '/github_status.json') test_json = json.load(myfile) for test in test_json['tests']: smolder.http_test(test, 'status.github.com', False) reload(smolder) assert smolder.failed_tests == 0 def test_github_status_response_time_expect_fail(): myfile = open(THIS_DIR + '/harsh_github_status.json') test_json = json.load(myfile) for test in test_json['tests']: smolder.http_test(test, 'status.github.com', False) reload(smolder) assert smolder.failed_tests > 0 def test_tcp_test(): smolder.tcp_test('127.0.0.1', 22) #Are you running an ssh server? def test_fail_tcp_test(): assert_raises(Exception, smolder.tcp_test, '127.0.0.1', 4242) <commit_msg>Clean up imports in smolder tests<commit_after>
#!/usr/bin/env python2 import smolder import json import os from nose.tools import assert_raises from imp import reload THIS_DIR = os.path.dirname(os.path.realpath(__file__)) def test_noop_test(): assert smolder.noop_test() def test_github_status(): myfile = open(THIS_DIR + '/github_status.json') test_json = json.load(myfile) for test in test_json['tests']: smolder.http_test(test, 'status.github.com', False) reload(smolder) assert smolder.failed_tests == 0 def test_github_status_response_time_expect_fail(): myfile = open(THIS_DIR + '/harsh_github_status.json') test_json = json.load(myfile) for test in test_json['tests']: smolder.http_test(test, 'status.github.com', False) reload(smolder) assert smolder.failed_tests > 0 def test_tcp_test(): smolder.tcp_test('127.0.0.1', 22) #Are you running an ssh server? def test_fail_tcp_test(): assert_raises(Exception, smolder.tcp_test, '127.0.0.1', 4242)
#!/usr/bin/env python2 import smolder import nose import json import os from nose.tools import assert_raises from imp import reload THIS_DIR = os.path.dirname(os.path.realpath(__file__)) def test_noop_test(): assert smolder.noop_test() def test_github_status(): myfile = open(THIS_DIR + '/github_status.json') test_json = json.load(myfile) for test in test_json['tests']: smolder.http_test(test, 'status.github.com', False) reload(smolder) assert smolder.failed_tests == 0 def test_github_status_response_time_expect_fail(): myfile = open(THIS_DIR + '/harsh_github_status.json') test_json = json.load(myfile) for test in test_json['tests']: smolder.http_test(test, 'status.github.com', False) reload(smolder) assert smolder.failed_tests > 0 def test_tcp_test(): smolder.tcp_test('127.0.0.1', 22) #Are you running an ssh server? def test_fail_tcp_test(): assert_raises(Exception, smolder.tcp_test, '127.0.0.1', 4242) Clean up imports in smolder tests#!/usr/bin/env python2 import smolder import json import os from nose.tools import assert_raises from imp import reload THIS_DIR = os.path.dirname(os.path.realpath(__file__)) def test_noop_test(): assert smolder.noop_test() def test_github_status(): myfile = open(THIS_DIR + '/github_status.json') test_json = json.load(myfile) for test in test_json['tests']: smolder.http_test(test, 'status.github.com', False) reload(smolder) assert smolder.failed_tests == 0 def test_github_status_response_time_expect_fail(): myfile = open(THIS_DIR + '/harsh_github_status.json') test_json = json.load(myfile) for test in test_json['tests']: smolder.http_test(test, 'status.github.com', False) reload(smolder) assert smolder.failed_tests > 0 def test_tcp_test(): smolder.tcp_test('127.0.0.1', 22) #Are you running an ssh server? def test_fail_tcp_test(): assert_raises(Exception, smolder.tcp_test, '127.0.0.1', 4242)
<commit_before>#!/usr/bin/env python2 import smolder import nose import json import os from nose.tools import assert_raises from imp import reload THIS_DIR = os.path.dirname(os.path.realpath(__file__)) def test_noop_test(): assert smolder.noop_test() def test_github_status(): myfile = open(THIS_DIR + '/github_status.json') test_json = json.load(myfile) for test in test_json['tests']: smolder.http_test(test, 'status.github.com', False) reload(smolder) assert smolder.failed_tests == 0 def test_github_status_response_time_expect_fail(): myfile = open(THIS_DIR + '/harsh_github_status.json') test_json = json.load(myfile) for test in test_json['tests']: smolder.http_test(test, 'status.github.com', False) reload(smolder) assert smolder.failed_tests > 0 def test_tcp_test(): smolder.tcp_test('127.0.0.1', 22) #Are you running an ssh server? def test_fail_tcp_test(): assert_raises(Exception, smolder.tcp_test, '127.0.0.1', 4242) <commit_msg>Clean up imports in smolder tests<commit_after>#!/usr/bin/env python2 import smolder import json import os from nose.tools import assert_raises from imp import reload THIS_DIR = os.path.dirname(os.path.realpath(__file__)) def test_noop_test(): assert smolder.noop_test() def test_github_status(): myfile = open(THIS_DIR + '/github_status.json') test_json = json.load(myfile) for test in test_json['tests']: smolder.http_test(test, 'status.github.com', False) reload(smolder) assert smolder.failed_tests == 0 def test_github_status_response_time_expect_fail(): myfile = open(THIS_DIR + '/harsh_github_status.json') test_json = json.load(myfile) for test in test_json['tests']: smolder.http_test(test, 'status.github.com', False) reload(smolder) assert smolder.failed_tests > 0 def test_tcp_test(): smolder.tcp_test('127.0.0.1', 22) #Are you running an ssh server? def test_fail_tcp_test(): assert_raises(Exception, smolder.tcp_test, '127.0.0.1', 4242)
6e80bcef30b6b4485fa5e3f269f13fc62380c422
tests/test_evaluate.py
tests/test_evaluate.py
import numpy as np from numpy.testing import assert_equal from gala import evaluate as ev def test_contingency_table(): seg = np.array([0, 1, 1, 1, 2, 2, 2, 3]) gt = np.array([1, 1, 1, 2, 2, 2, 2, 0]) ct = ev.contingency_table(seg, gt, ignore_seg=[], ignore_gt=[]) ct0 = ev.contingency_table(seg, gt, ignore_seg=[0], ignore_gt=[0]) ctd = ct.todense() assert_equal(ctd, np.array([[0. , 0.125, 0. ], [0. , 0.25 , 0.125], [0. , 0. , 0.375], [0.125, 0. , 0. ]])) assert ct.shape == ct0.shape def test_vi(): seg = np.array([1, 2, 3, 4]) gt = np.array([1, 1, 8, 8]) assert_equal(ev.vi(seg, gt), 1) def test_are(): seg = np.eye(3) gt = np.eye(3) seg[1][1] = 0 assert seg.shape == gt.shape
import numpy as np from numpy.testing import assert_equal from gala import evaluate as ev def test_contingency_table(): seg = np.array([0, 1, 1, 1, 2, 2, 2, 3]) gt = np.array([1, 1, 1, 2, 2, 2, 2, 0]) ct = ev.contingency_table(seg, gt, ignore_seg=[], ignore_gt=[]) ct0 = ev.contingency_table(seg, gt, ignore_seg=[0], ignore_gt=[0]) ctd = ct.todense() assert_equal(ctd, np.array([[0. , 0.125, 0. ], [0. , 0.25 , 0.125], [0. , 0. , 0.375], [0.125, 0. , 0. ]])) assert ct.shape == ct0.shape def test_vi(): seg = np.array([1, 2, 3, 4]) gt = np.array([1, 1, 8, 8]) assert_equal(ev.vi(seg, gt), 1) def test_are(): seg = np.array([[0,1], [1,0]]) gt = np.array([[1,2],[0,1]]) assert_almost_equal(ev.adapted_rand_error(seg,gt),0.081) assert seg.shape == gt.shape
Add in test for ARE
Add in test for ARE
Python
bsd-3-clause
jni/gala,janelia-flyem/gala
import numpy as np from numpy.testing import assert_equal from gala import evaluate as ev def test_contingency_table(): seg = np.array([0, 1, 1, 1, 2, 2, 2, 3]) gt = np.array([1, 1, 1, 2, 2, 2, 2, 0]) ct = ev.contingency_table(seg, gt, ignore_seg=[], ignore_gt=[]) ct0 = ev.contingency_table(seg, gt, ignore_seg=[0], ignore_gt=[0]) ctd = ct.todense() assert_equal(ctd, np.array([[0. , 0.125, 0. ], [0. , 0.25 , 0.125], [0. , 0. , 0.375], [0.125, 0. , 0. ]])) assert ct.shape == ct0.shape def test_vi(): seg = np.array([1, 2, 3, 4]) gt = np.array([1, 1, 8, 8]) assert_equal(ev.vi(seg, gt), 1) def test_are(): seg = np.eye(3) gt = np.eye(3) seg[1][1] = 0 assert seg.shape == gt.shape Add in test for ARE
import numpy as np from numpy.testing import assert_equal from gala import evaluate as ev def test_contingency_table(): seg = np.array([0, 1, 1, 1, 2, 2, 2, 3]) gt = np.array([1, 1, 1, 2, 2, 2, 2, 0]) ct = ev.contingency_table(seg, gt, ignore_seg=[], ignore_gt=[]) ct0 = ev.contingency_table(seg, gt, ignore_seg=[0], ignore_gt=[0]) ctd = ct.todense() assert_equal(ctd, np.array([[0. , 0.125, 0. ], [0. , 0.25 , 0.125], [0. , 0. , 0.375], [0.125, 0. , 0. ]])) assert ct.shape == ct0.shape def test_vi(): seg = np.array([1, 2, 3, 4]) gt = np.array([1, 1, 8, 8]) assert_equal(ev.vi(seg, gt), 1) def test_are(): seg = np.array([[0,1], [1,0]]) gt = np.array([[1,2],[0,1]]) assert_almost_equal(ev.adapted_rand_error(seg,gt),0.081) assert seg.shape == gt.shape
<commit_before>import numpy as np from numpy.testing import assert_equal from gala import evaluate as ev def test_contingency_table(): seg = np.array([0, 1, 1, 1, 2, 2, 2, 3]) gt = np.array([1, 1, 1, 2, 2, 2, 2, 0]) ct = ev.contingency_table(seg, gt, ignore_seg=[], ignore_gt=[]) ct0 = ev.contingency_table(seg, gt, ignore_seg=[0], ignore_gt=[0]) ctd = ct.todense() assert_equal(ctd, np.array([[0. , 0.125, 0. ], [0. , 0.25 , 0.125], [0. , 0. , 0.375], [0.125, 0. , 0. ]])) assert ct.shape == ct0.shape def test_vi(): seg = np.array([1, 2, 3, 4]) gt = np.array([1, 1, 8, 8]) assert_equal(ev.vi(seg, gt), 1) def test_are(): seg = np.eye(3) gt = np.eye(3) seg[1][1] = 0 assert seg.shape == gt.shape <commit_msg>Add in test for ARE<commit_after>
import numpy as np from numpy.testing import assert_equal from gala import evaluate as ev def test_contingency_table(): seg = np.array([0, 1, 1, 1, 2, 2, 2, 3]) gt = np.array([1, 1, 1, 2, 2, 2, 2, 0]) ct = ev.contingency_table(seg, gt, ignore_seg=[], ignore_gt=[]) ct0 = ev.contingency_table(seg, gt, ignore_seg=[0], ignore_gt=[0]) ctd = ct.todense() assert_equal(ctd, np.array([[0. , 0.125, 0. ], [0. , 0.25 , 0.125], [0. , 0. , 0.375], [0.125, 0. , 0. ]])) assert ct.shape == ct0.shape def test_vi(): seg = np.array([1, 2, 3, 4]) gt = np.array([1, 1, 8, 8]) assert_equal(ev.vi(seg, gt), 1) def test_are(): seg = np.array([[0,1], [1,0]]) gt = np.array([[1,2],[0,1]]) assert_almost_equal(ev.adapted_rand_error(seg,gt),0.081) assert seg.shape == gt.shape
import numpy as np from numpy.testing import assert_equal from gala import evaluate as ev def test_contingency_table(): seg = np.array([0, 1, 1, 1, 2, 2, 2, 3]) gt = np.array([1, 1, 1, 2, 2, 2, 2, 0]) ct = ev.contingency_table(seg, gt, ignore_seg=[], ignore_gt=[]) ct0 = ev.contingency_table(seg, gt, ignore_seg=[0], ignore_gt=[0]) ctd = ct.todense() assert_equal(ctd, np.array([[0. , 0.125, 0. ], [0. , 0.25 , 0.125], [0. , 0. , 0.375], [0.125, 0. , 0. ]])) assert ct.shape == ct0.shape def test_vi(): seg = np.array([1, 2, 3, 4]) gt = np.array([1, 1, 8, 8]) assert_equal(ev.vi(seg, gt), 1) def test_are(): seg = np.eye(3) gt = np.eye(3) seg[1][1] = 0 assert seg.shape == gt.shape Add in test for AREimport numpy as np from numpy.testing import assert_equal from gala import evaluate as ev def test_contingency_table(): seg = np.array([0, 1, 1, 1, 2, 2, 2, 3]) gt = np.array([1, 1, 1, 2, 2, 2, 2, 0]) ct = ev.contingency_table(seg, gt, ignore_seg=[], ignore_gt=[]) ct0 = ev.contingency_table(seg, gt, ignore_seg=[0], ignore_gt=[0]) ctd = ct.todense() assert_equal(ctd, np.array([[0. , 0.125, 0. ], [0. , 0.25 , 0.125], [0. , 0. , 0.375], [0.125, 0. , 0. ]])) assert ct.shape == ct0.shape def test_vi(): seg = np.array([1, 2, 3, 4]) gt = np.array([1, 1, 8, 8]) assert_equal(ev.vi(seg, gt), 1) def test_are(): seg = np.array([[0,1], [1,0]]) gt = np.array([[1,2],[0,1]]) assert_almost_equal(ev.adapted_rand_error(seg,gt),0.081) assert seg.shape == gt.shape
<commit_before>import numpy as np from numpy.testing import assert_equal from gala import evaluate as ev def test_contingency_table(): seg = np.array([0, 1, 1, 1, 2, 2, 2, 3]) gt = np.array([1, 1, 1, 2, 2, 2, 2, 0]) ct = ev.contingency_table(seg, gt, ignore_seg=[], ignore_gt=[]) ct0 = ev.contingency_table(seg, gt, ignore_seg=[0], ignore_gt=[0]) ctd = ct.todense() assert_equal(ctd, np.array([[0. , 0.125, 0. ], [0. , 0.25 , 0.125], [0. , 0. , 0.375], [0.125, 0. , 0. ]])) assert ct.shape == ct0.shape def test_vi(): seg = np.array([1, 2, 3, 4]) gt = np.array([1, 1, 8, 8]) assert_equal(ev.vi(seg, gt), 1) def test_are(): seg = np.eye(3) gt = np.eye(3) seg[1][1] = 0 assert seg.shape == gt.shape <commit_msg>Add in test for ARE<commit_after>import numpy as np from numpy.testing import assert_equal from gala import evaluate as ev def test_contingency_table(): seg = np.array([0, 1, 1, 1, 2, 2, 2, 3]) gt = np.array([1, 1, 1, 2, 2, 2, 2, 0]) ct = ev.contingency_table(seg, gt, ignore_seg=[], ignore_gt=[]) ct0 = ev.contingency_table(seg, gt, ignore_seg=[0], ignore_gt=[0]) ctd = ct.todense() assert_equal(ctd, np.array([[0. , 0.125, 0. ], [0. , 0.25 , 0.125], [0. , 0. , 0.375], [0.125, 0. , 0. ]])) assert ct.shape == ct0.shape def test_vi(): seg = np.array([1, 2, 3, 4]) gt = np.array([1, 1, 8, 8]) assert_equal(ev.vi(seg, gt), 1) def test_are(): seg = np.array([[0,1], [1,0]]) gt = np.array([[1,2],[0,1]]) assert_almost_equal(ev.adapted_rand_error(seg,gt),0.081) assert seg.shape == gt.shape
11fb371098b258348e5b9efc92abe31f2cac5ef3
tests/test_settings.py
tests/test_settings.py
from os.path import dirname, join TEST_ROOT = dirname(__file__) INSTALLED_APPS = ('adminfiles', 'tests', 'django.contrib.contenttypes', 'django.contrib.admin', 'django.contrib.sites', 'django.contrib.auth', 'django.contrib.sessions', 'sorl.thumbnail') DATABASE_ENGINE = 'sqlite3' SITE_ID = 1 MEDIA_URL = '/media/' MEDIA_ROOT = join(TEST_ROOT, 'media') STATIC_URL = '/static/' STATIC_ROOT = MEDIA_ROOT ROOT_URLCONF = 'tests.urls' TEMPLATE_DIRS = (join(TEST_ROOT, 'templates'),)
from os.path import dirname, join TEST_ROOT = dirname(__file__) INSTALLED_APPS = ('adminfiles', 'tests', 'django.contrib.contenttypes', 'django.contrib.admin', 'django.contrib.sites', 'django.contrib.auth', 'django.contrib.sessions', 'sorl.thumbnail') DATABASES = { "default": { "ENGINE": 'django.db.backends.sqlite3', } } SITE_ID = 1 MEDIA_URL = '/media/' MEDIA_ROOT = join(TEST_ROOT, 'media') STATIC_URL = '/static/' STATIC_ROOT = MEDIA_ROOT ROOT_URLCONF = 'tests.urls' TEMPLATE_DIRS = (join(TEST_ROOT, 'templates'),)
Fix deprecation warning: DATABASE_* -> DATABASES
Fix deprecation warning: DATABASE_* -> DATABASES
Python
bsd-3-clause
carljm/django-adminfiles,carljm/django-adminfiles,carljm/django-adminfiles
from os.path import dirname, join TEST_ROOT = dirname(__file__) INSTALLED_APPS = ('adminfiles', 'tests', 'django.contrib.contenttypes', 'django.contrib.admin', 'django.contrib.sites', 'django.contrib.auth', 'django.contrib.sessions', 'sorl.thumbnail') DATABASE_ENGINE = 'sqlite3' SITE_ID = 1 MEDIA_URL = '/media/' MEDIA_ROOT = join(TEST_ROOT, 'media') STATIC_URL = '/static/' STATIC_ROOT = MEDIA_ROOT ROOT_URLCONF = 'tests.urls' TEMPLATE_DIRS = (join(TEST_ROOT, 'templates'),) Fix deprecation warning: DATABASE_* -> DATABASES
from os.path import dirname, join TEST_ROOT = dirname(__file__) INSTALLED_APPS = ('adminfiles', 'tests', 'django.contrib.contenttypes', 'django.contrib.admin', 'django.contrib.sites', 'django.contrib.auth', 'django.contrib.sessions', 'sorl.thumbnail') DATABASES = { "default": { "ENGINE": 'django.db.backends.sqlite3', } } SITE_ID = 1 MEDIA_URL = '/media/' MEDIA_ROOT = join(TEST_ROOT, 'media') STATIC_URL = '/static/' STATIC_ROOT = MEDIA_ROOT ROOT_URLCONF = 'tests.urls' TEMPLATE_DIRS = (join(TEST_ROOT, 'templates'),)
<commit_before>from os.path import dirname, join TEST_ROOT = dirname(__file__) INSTALLED_APPS = ('adminfiles', 'tests', 'django.contrib.contenttypes', 'django.contrib.admin', 'django.contrib.sites', 'django.contrib.auth', 'django.contrib.sessions', 'sorl.thumbnail') DATABASE_ENGINE = 'sqlite3' SITE_ID = 1 MEDIA_URL = '/media/' MEDIA_ROOT = join(TEST_ROOT, 'media') STATIC_URL = '/static/' STATIC_ROOT = MEDIA_ROOT ROOT_URLCONF = 'tests.urls' TEMPLATE_DIRS = (join(TEST_ROOT, 'templates'),) <commit_msg>Fix deprecation warning: DATABASE_* -> DATABASES<commit_after>
from os.path import dirname, join TEST_ROOT = dirname(__file__) INSTALLED_APPS = ('adminfiles', 'tests', 'django.contrib.contenttypes', 'django.contrib.admin', 'django.contrib.sites', 'django.contrib.auth', 'django.contrib.sessions', 'sorl.thumbnail') DATABASES = { "default": { "ENGINE": 'django.db.backends.sqlite3', } } SITE_ID = 1 MEDIA_URL = '/media/' MEDIA_ROOT = join(TEST_ROOT, 'media') STATIC_URL = '/static/' STATIC_ROOT = MEDIA_ROOT ROOT_URLCONF = 'tests.urls' TEMPLATE_DIRS = (join(TEST_ROOT, 'templates'),)
from os.path import dirname, join TEST_ROOT = dirname(__file__) INSTALLED_APPS = ('adminfiles', 'tests', 'django.contrib.contenttypes', 'django.contrib.admin', 'django.contrib.sites', 'django.contrib.auth', 'django.contrib.sessions', 'sorl.thumbnail') DATABASE_ENGINE = 'sqlite3' SITE_ID = 1 MEDIA_URL = '/media/' MEDIA_ROOT = join(TEST_ROOT, 'media') STATIC_URL = '/static/' STATIC_ROOT = MEDIA_ROOT ROOT_URLCONF = 'tests.urls' TEMPLATE_DIRS = (join(TEST_ROOT, 'templates'),) Fix deprecation warning: DATABASE_* -> DATABASESfrom os.path import dirname, join TEST_ROOT = dirname(__file__) INSTALLED_APPS = ('adminfiles', 'tests', 'django.contrib.contenttypes', 'django.contrib.admin', 'django.contrib.sites', 'django.contrib.auth', 'django.contrib.sessions', 'sorl.thumbnail') DATABASES = { "default": { "ENGINE": 'django.db.backends.sqlite3', } } SITE_ID = 1 MEDIA_URL = '/media/' MEDIA_ROOT = join(TEST_ROOT, 'media') STATIC_URL = '/static/' STATIC_ROOT = MEDIA_ROOT ROOT_URLCONF = 'tests.urls' TEMPLATE_DIRS = (join(TEST_ROOT, 'templates'),)
<commit_before>from os.path import dirname, join TEST_ROOT = dirname(__file__) INSTALLED_APPS = ('adminfiles', 'tests', 'django.contrib.contenttypes', 'django.contrib.admin', 'django.contrib.sites', 'django.contrib.auth', 'django.contrib.sessions', 'sorl.thumbnail') DATABASE_ENGINE = 'sqlite3' SITE_ID = 1 MEDIA_URL = '/media/' MEDIA_ROOT = join(TEST_ROOT, 'media') STATIC_URL = '/static/' STATIC_ROOT = MEDIA_ROOT ROOT_URLCONF = 'tests.urls' TEMPLATE_DIRS = (join(TEST_ROOT, 'templates'),) <commit_msg>Fix deprecation warning: DATABASE_* -> DATABASES<commit_after>from os.path import dirname, join TEST_ROOT = dirname(__file__) INSTALLED_APPS = ('adminfiles', 'tests', 'django.contrib.contenttypes', 'django.contrib.admin', 'django.contrib.sites', 'django.contrib.auth', 'django.contrib.sessions', 'sorl.thumbnail') DATABASES = { "default": { "ENGINE": 'django.db.backends.sqlite3', } } SITE_ID = 1 MEDIA_URL = '/media/' MEDIA_ROOT = join(TEST_ROOT, 'media') STATIC_URL = '/static/' STATIC_ROOT = MEDIA_ROOT ROOT_URLCONF = 'tests.urls' TEMPLATE_DIRS = (join(TEST_ROOT, 'templates'),)
0bdea433da15d70ce841edbffb9316085ca8a647
main.py
main.py
#! /usr/bin/env python import numpy as np def plot_elevation(avulsion): import matplotlib.pyplot as plt z = avulsion.get_value('land_surface__elevation') plt.imshow(z, origin='lower', cmap='terrain') plt.colorbar().ax.set_label('Elevation (m)') plt.show() def main(): import argparse from avulsion_bmi import BmiRiverModule parser = argparse.ArgumentParser('Run the avulsion model') parser.add_argument('file', help='YAML-formatted parameters file') parser.add_argument('--days', type=int, default=0, help='Run model for DAYS') parser.add_argument('--years', type=int, default=0, help='Run model for YEARS') parser.add_argument('--plot', action='store_true', help='Plot final elevations') args = parser.parse_args() np.random.seed(1945) avulsion = BmiRiverModule() avulsion.initialize(args.file) n_steps = int((args.days + args.years * 365.) / avulsion.get_time_step()) for _ in xrange(n_steps): avulsion.update() if args.plot: plot_elevation(avulsion) avulsion.finalize() if __name__ == '__main__': main()
#! /usr/bin/env python import sys import numpy as np def plot_elevation(avulsion): import matplotlib.pyplot as plt z = avulsion.get_value('land_surface__elevation') plt.imshow(z, origin='lower', cmap='terrain') plt.colorbar().ax.set_label('Elevation (m)') plt.show() def main(): import argparse from avulsion_bmi import BmiRiverModule parser = argparse.ArgumentParser('Run the avulsion model') parser.add_argument('file', help='YAML-formatted parameters file') parser.add_argument('--days', type=int, default=0, help='Run model for DAYS') parser.add_argument('--years', type=int, default=0, help='Run model for YEARS') parser.add_argument('--plot', action='store_true', help='Plot final elevations') args = parser.parse_args() np.random.seed(1945) avulsion = BmiRiverModule() avulsion.initialize(args.file) n_steps = int((args.days + args.years * 365.) / avulsion.get_time_step()) for _ in xrange(n_steps): avulsion.update() if args.plot: plot_elevation(avulsion) z = avulsion.get_value('land_surface__elevation') np.savetxt(sys.stdout, z) avulsion.finalize() if __name__ == '__main__': main()
Print final surface elevations to stdout.
Print final surface elevations to stdout.
Python
mit
mcflugen/avulsion-bmi,katmratliff/avulsion-bmi
#! /usr/bin/env python import numpy as np def plot_elevation(avulsion): import matplotlib.pyplot as plt z = avulsion.get_value('land_surface__elevation') plt.imshow(z, origin='lower', cmap='terrain') plt.colorbar().ax.set_label('Elevation (m)') plt.show() def main(): import argparse from avulsion_bmi import BmiRiverModule parser = argparse.ArgumentParser('Run the avulsion model') parser.add_argument('file', help='YAML-formatted parameters file') parser.add_argument('--days', type=int, default=0, help='Run model for DAYS') parser.add_argument('--years', type=int, default=0, help='Run model for YEARS') parser.add_argument('--plot', action='store_true', help='Plot final elevations') args = parser.parse_args() np.random.seed(1945) avulsion = BmiRiverModule() avulsion.initialize(args.file) n_steps = int((args.days + args.years * 365.) / avulsion.get_time_step()) for _ in xrange(n_steps): avulsion.update() if args.plot: plot_elevation(avulsion) avulsion.finalize() if __name__ == '__main__': main() Print final surface elevations to stdout.
#! /usr/bin/env python import sys import numpy as np def plot_elevation(avulsion): import matplotlib.pyplot as plt z = avulsion.get_value('land_surface__elevation') plt.imshow(z, origin='lower', cmap='terrain') plt.colorbar().ax.set_label('Elevation (m)') plt.show() def main(): import argparse from avulsion_bmi import BmiRiverModule parser = argparse.ArgumentParser('Run the avulsion model') parser.add_argument('file', help='YAML-formatted parameters file') parser.add_argument('--days', type=int, default=0, help='Run model for DAYS') parser.add_argument('--years', type=int, default=0, help='Run model for YEARS') parser.add_argument('--plot', action='store_true', help='Plot final elevations') args = parser.parse_args() np.random.seed(1945) avulsion = BmiRiverModule() avulsion.initialize(args.file) n_steps = int((args.days + args.years * 365.) / avulsion.get_time_step()) for _ in xrange(n_steps): avulsion.update() if args.plot: plot_elevation(avulsion) z = avulsion.get_value('land_surface__elevation') np.savetxt(sys.stdout, z) avulsion.finalize() if __name__ == '__main__': main()
<commit_before>#! /usr/bin/env python import numpy as np def plot_elevation(avulsion): import matplotlib.pyplot as plt z = avulsion.get_value('land_surface__elevation') plt.imshow(z, origin='lower', cmap='terrain') plt.colorbar().ax.set_label('Elevation (m)') plt.show() def main(): import argparse from avulsion_bmi import BmiRiverModule parser = argparse.ArgumentParser('Run the avulsion model') parser.add_argument('file', help='YAML-formatted parameters file') parser.add_argument('--days', type=int, default=0, help='Run model for DAYS') parser.add_argument('--years', type=int, default=0, help='Run model for YEARS') parser.add_argument('--plot', action='store_true', help='Plot final elevations') args = parser.parse_args() np.random.seed(1945) avulsion = BmiRiverModule() avulsion.initialize(args.file) n_steps = int((args.days + args.years * 365.) / avulsion.get_time_step()) for _ in xrange(n_steps): avulsion.update() if args.plot: plot_elevation(avulsion) avulsion.finalize() if __name__ == '__main__': main() <commit_msg>Print final surface elevations to stdout.<commit_after>
#! /usr/bin/env python import sys import numpy as np def plot_elevation(avulsion): import matplotlib.pyplot as plt z = avulsion.get_value('land_surface__elevation') plt.imshow(z, origin='lower', cmap='terrain') plt.colorbar().ax.set_label('Elevation (m)') plt.show() def main(): import argparse from avulsion_bmi import BmiRiverModule parser = argparse.ArgumentParser('Run the avulsion model') parser.add_argument('file', help='YAML-formatted parameters file') parser.add_argument('--days', type=int, default=0, help='Run model for DAYS') parser.add_argument('--years', type=int, default=0, help='Run model for YEARS') parser.add_argument('--plot', action='store_true', help='Plot final elevations') args = parser.parse_args() np.random.seed(1945) avulsion = BmiRiverModule() avulsion.initialize(args.file) n_steps = int((args.days + args.years * 365.) / avulsion.get_time_step()) for _ in xrange(n_steps): avulsion.update() if args.plot: plot_elevation(avulsion) z = avulsion.get_value('land_surface__elevation') np.savetxt(sys.stdout, z) avulsion.finalize() if __name__ == '__main__': main()
#! /usr/bin/env python import numpy as np def plot_elevation(avulsion): import matplotlib.pyplot as plt z = avulsion.get_value('land_surface__elevation') plt.imshow(z, origin='lower', cmap='terrain') plt.colorbar().ax.set_label('Elevation (m)') plt.show() def main(): import argparse from avulsion_bmi import BmiRiverModule parser = argparse.ArgumentParser('Run the avulsion model') parser.add_argument('file', help='YAML-formatted parameters file') parser.add_argument('--days', type=int, default=0, help='Run model for DAYS') parser.add_argument('--years', type=int, default=0, help='Run model for YEARS') parser.add_argument('--plot', action='store_true', help='Plot final elevations') args = parser.parse_args() np.random.seed(1945) avulsion = BmiRiverModule() avulsion.initialize(args.file) n_steps = int((args.days + args.years * 365.) / avulsion.get_time_step()) for _ in xrange(n_steps): avulsion.update() if args.plot: plot_elevation(avulsion) avulsion.finalize() if __name__ == '__main__': main() Print final surface elevations to stdout.#! /usr/bin/env python import sys import numpy as np def plot_elevation(avulsion): import matplotlib.pyplot as plt z = avulsion.get_value('land_surface__elevation') plt.imshow(z, origin='lower', cmap='terrain') plt.colorbar().ax.set_label('Elevation (m)') plt.show() def main(): import argparse from avulsion_bmi import BmiRiverModule parser = argparse.ArgumentParser('Run the avulsion model') parser.add_argument('file', help='YAML-formatted parameters file') parser.add_argument('--days', type=int, default=0, help='Run model for DAYS') parser.add_argument('--years', type=int, default=0, help='Run model for YEARS') parser.add_argument('--plot', action='store_true', help='Plot final elevations') args = parser.parse_args() np.random.seed(1945) avulsion = BmiRiverModule() avulsion.initialize(args.file) n_steps = int((args.days + args.years * 365.) / avulsion.get_time_step()) for _ in xrange(n_steps): avulsion.update() if args.plot: plot_elevation(avulsion) z = avulsion.get_value('land_surface__elevation') np.savetxt(sys.stdout, z) avulsion.finalize() if __name__ == '__main__': main()
<commit_before>#! /usr/bin/env python import numpy as np def plot_elevation(avulsion): import matplotlib.pyplot as plt z = avulsion.get_value('land_surface__elevation') plt.imshow(z, origin='lower', cmap='terrain') plt.colorbar().ax.set_label('Elevation (m)') plt.show() def main(): import argparse from avulsion_bmi import BmiRiverModule parser = argparse.ArgumentParser('Run the avulsion model') parser.add_argument('file', help='YAML-formatted parameters file') parser.add_argument('--days', type=int, default=0, help='Run model for DAYS') parser.add_argument('--years', type=int, default=0, help='Run model for YEARS') parser.add_argument('--plot', action='store_true', help='Plot final elevations') args = parser.parse_args() np.random.seed(1945) avulsion = BmiRiverModule() avulsion.initialize(args.file) n_steps = int((args.days + args.years * 365.) / avulsion.get_time_step()) for _ in xrange(n_steps): avulsion.update() if args.plot: plot_elevation(avulsion) avulsion.finalize() if __name__ == '__main__': main() <commit_msg>Print final surface elevations to stdout.<commit_after>#! /usr/bin/env python import sys import numpy as np def plot_elevation(avulsion): import matplotlib.pyplot as plt z = avulsion.get_value('land_surface__elevation') plt.imshow(z, origin='lower', cmap='terrain') plt.colorbar().ax.set_label('Elevation (m)') plt.show() def main(): import argparse from avulsion_bmi import BmiRiverModule parser = argparse.ArgumentParser('Run the avulsion model') parser.add_argument('file', help='YAML-formatted parameters file') parser.add_argument('--days', type=int, default=0, help='Run model for DAYS') parser.add_argument('--years', type=int, default=0, help='Run model for YEARS') parser.add_argument('--plot', action='store_true', help='Plot final elevations') args = parser.parse_args() np.random.seed(1945) avulsion = BmiRiverModule() avulsion.initialize(args.file) n_steps = int((args.days + args.years * 365.) / avulsion.get_time_step()) for _ in xrange(n_steps): avulsion.update() if args.plot: plot_elevation(avulsion) z = avulsion.get_value('land_surface__elevation') np.savetxt(sys.stdout, z) avulsion.finalize() if __name__ == '__main__': main()
1ee1496439f4dcd654df0a1f119b05a8288e3dd2
query.py
query.py
from numpy import uint16 from numpy import bool_ from query_result_list import QueryResultList from data_record import DataRecord from has_actions import HasActions class Query(DataRecord, HasActions): def __init__(self, query_id, topic = None, result_list = None, user = None, condition = None, autocomplete = None, query_text = None): DataRecord.__init__( self, uint16(query_id) ) self.topic = topic self.result_list = result_list self.user = user self.condition = condition self.autocomplete = bool_(autocomplete) self.query_text = query_text if result_list is None: self.result_list = QueryResultList(self) def add_to_result_list( self, rank, document ): self.result_list.add( rank, document ) def results_up_to_rank( self, rank ): return self.result_list.results_up_to_rank( rank )
from numpy import uint16 from numpy import bool_ from query_result_list import QueryResultList from data_record import DataRecord from has_actions import HasActions class Query(DataRecord, HasActions): def __init__(self, query_id, topic = None, user = None, condition = None, autocomplete = None, query_text = None): DataRecord.__init__( self, uint16(query_id) ) self.topic = topic self.user = user self.condition = condition self.autocomplete = bool_(autocomplete) self.query_text = query_text self.result_list = QueryResultList(self) def add_to_result_list( self, rank, document ): self.result_list.add( rank, document ) def results_up_to_rank( self, rank ): if int(rank) < 1 or int(rank) > self.result_list.length(): raise RuntimeError("Attempted to fetch results up to rank %s for query %s, which is impossible." % (rank, self.record_id)) return self.result_list.results_up_to_rank( rank )
Remove result list handling from Query constructor
Remove result list handling from Query constructor
Python
mit
fire-uta/iiix-data-parser
from numpy import uint16 from numpy import bool_ from query_result_list import QueryResultList from data_record import DataRecord from has_actions import HasActions class Query(DataRecord, HasActions): def __init__(self, query_id, topic = None, result_list = None, user = None, condition = None, autocomplete = None, query_text = None): DataRecord.__init__( self, uint16(query_id) ) self.topic = topic self.result_list = result_list self.user = user self.condition = condition self.autocomplete = bool_(autocomplete) self.query_text = query_text if result_list is None: self.result_list = QueryResultList(self) def add_to_result_list( self, rank, document ): self.result_list.add( rank, document ) def results_up_to_rank( self, rank ): return self.result_list.results_up_to_rank( rank ) Remove result list handling from Query constructor
from numpy import uint16 from numpy import bool_ from query_result_list import QueryResultList from data_record import DataRecord from has_actions import HasActions class Query(DataRecord, HasActions): def __init__(self, query_id, topic = None, user = None, condition = None, autocomplete = None, query_text = None): DataRecord.__init__( self, uint16(query_id) ) self.topic = topic self.user = user self.condition = condition self.autocomplete = bool_(autocomplete) self.query_text = query_text self.result_list = QueryResultList(self) def add_to_result_list( self, rank, document ): self.result_list.add( rank, document ) def results_up_to_rank( self, rank ): if int(rank) < 1 or int(rank) > self.result_list.length(): raise RuntimeError("Attempted to fetch results up to rank %s for query %s, which is impossible." % (rank, self.record_id)) return self.result_list.results_up_to_rank( rank )
<commit_before>from numpy import uint16 from numpy import bool_ from query_result_list import QueryResultList from data_record import DataRecord from has_actions import HasActions class Query(DataRecord, HasActions): def __init__(self, query_id, topic = None, result_list = None, user = None, condition = None, autocomplete = None, query_text = None): DataRecord.__init__( self, uint16(query_id) ) self.topic = topic self.result_list = result_list self.user = user self.condition = condition self.autocomplete = bool_(autocomplete) self.query_text = query_text if result_list is None: self.result_list = QueryResultList(self) def add_to_result_list( self, rank, document ): self.result_list.add( rank, document ) def results_up_to_rank( self, rank ): return self.result_list.results_up_to_rank( rank ) <commit_msg>Remove result list handling from Query constructor<commit_after>
from numpy import uint16 from numpy import bool_ from query_result_list import QueryResultList from data_record import DataRecord from has_actions import HasActions class Query(DataRecord, HasActions): def __init__(self, query_id, topic = None, user = None, condition = None, autocomplete = None, query_text = None): DataRecord.__init__( self, uint16(query_id) ) self.topic = topic self.user = user self.condition = condition self.autocomplete = bool_(autocomplete) self.query_text = query_text self.result_list = QueryResultList(self) def add_to_result_list( self, rank, document ): self.result_list.add( rank, document ) def results_up_to_rank( self, rank ): if int(rank) < 1 or int(rank) > self.result_list.length(): raise RuntimeError("Attempted to fetch results up to rank %s for query %s, which is impossible." % (rank, self.record_id)) return self.result_list.results_up_to_rank( rank )
from numpy import uint16 from numpy import bool_ from query_result_list import QueryResultList from data_record import DataRecord from has_actions import HasActions class Query(DataRecord, HasActions): def __init__(self, query_id, topic = None, result_list = None, user = None, condition = None, autocomplete = None, query_text = None): DataRecord.__init__( self, uint16(query_id) ) self.topic = topic self.result_list = result_list self.user = user self.condition = condition self.autocomplete = bool_(autocomplete) self.query_text = query_text if result_list is None: self.result_list = QueryResultList(self) def add_to_result_list( self, rank, document ): self.result_list.add( rank, document ) def results_up_to_rank( self, rank ): return self.result_list.results_up_to_rank( rank ) Remove result list handling from Query constructorfrom numpy import uint16 from numpy import bool_ from query_result_list import QueryResultList from data_record import DataRecord from has_actions import HasActions class Query(DataRecord, HasActions): def __init__(self, query_id, topic = None, user = None, condition = None, autocomplete = None, query_text = None): DataRecord.__init__( self, uint16(query_id) ) self.topic = topic self.user = user self.condition = condition self.autocomplete = bool_(autocomplete) self.query_text = query_text self.result_list = QueryResultList(self) def add_to_result_list( self, rank, document ): self.result_list.add( rank, document ) def results_up_to_rank( self, rank ): if int(rank) < 1 or int(rank) > self.result_list.length(): raise RuntimeError("Attempted to fetch results up to rank %s for query %s, which is impossible." % (rank, self.record_id)) return self.result_list.results_up_to_rank( rank )
<commit_before>from numpy import uint16 from numpy import bool_ from query_result_list import QueryResultList from data_record import DataRecord from has_actions import HasActions class Query(DataRecord, HasActions): def __init__(self, query_id, topic = None, result_list = None, user = None, condition = None, autocomplete = None, query_text = None): DataRecord.__init__( self, uint16(query_id) ) self.topic = topic self.result_list = result_list self.user = user self.condition = condition self.autocomplete = bool_(autocomplete) self.query_text = query_text if result_list is None: self.result_list = QueryResultList(self) def add_to_result_list( self, rank, document ): self.result_list.add( rank, document ) def results_up_to_rank( self, rank ): return self.result_list.results_up_to_rank( rank ) <commit_msg>Remove result list handling from Query constructor<commit_after>from numpy import uint16 from numpy import bool_ from query_result_list import QueryResultList from data_record import DataRecord from has_actions import HasActions class Query(DataRecord, HasActions): def __init__(self, query_id, topic = None, user = None, condition = None, autocomplete = None, query_text = None): DataRecord.__init__( self, uint16(query_id) ) self.topic = topic self.user = user self.condition = condition self.autocomplete = bool_(autocomplete) self.query_text = query_text self.result_list = QueryResultList(self) def add_to_result_list( self, rank, document ): self.result_list.add( rank, document ) def results_up_to_rank( self, rank ): if int(rank) < 1 or int(rank) > self.result_list.length(): raise RuntimeError("Attempted to fetch results up to rank %s for query %s, which is impossible." % (rank, self.record_id)) return self.result_list.results_up_to_rank( rank )
3884cfe88486342232f509c14349ae9f7c13adc6
setup.py
setup.py
import os from setuptools import setup, find_packages VERSION = '0.1.3a1' README_FILENAME = 'README.rst' readme = open(os.path.join(os.path.dirname(__file__), README_FILENAME)) long_description = readme.read() readme.close() setup( name='django-cbv-formpreview', version=VERSION, author='Ryan Kaskel', author_email='[email protected]', url='https://github.com/ryankask/django-cbv-formpreview', license='BSD', description='Django\'s FormPreview updated to use class based views.', long_description=long_description, packages=find_packages(), package_data = { 'cbv_formpreview': ['templates/*.html', 'templates/formtools/*.html'] }, zip_safe=False, classifiers=[ 'Environment :: Web Environment', 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Framework :: Django', ], test_suite='cbv_formpreview.tests.runtests.runtests' )
import os from setuptools import setup, find_packages VERSION = '0.2.0a1' README_FILENAME = 'README.rst' readme = open(os.path.join(os.path.dirname(__file__), README_FILENAME)) long_description = readme.read() readme.close() setup( name='django-cbv-formpreview', version=VERSION, author='Ryan Kaskel', author_email='[email protected]', url='https://github.com/ryankask/django-cbv-formpreview', license='BSD', description='Django\'s FormPreview updated to use class based views.', long_description=long_description, packages=find_packages(), package_data = { 'cbv_formpreview': ['templates/cbv_formpreview/*.html'] }, zip_safe=False, classifiers=[ 'Environment :: Web Environment', 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Framework :: Django', ], test_suite='cbv_formpreview.tests.runtests.runtests' )
Update package data and version number.
Update package data and version number.
Python
bsd-3-clause
ryankask/django-cbv-formpreview,ryankask/django-cbv-formpreview
import os from setuptools import setup, find_packages VERSION = '0.1.3a1' README_FILENAME = 'README.rst' readme = open(os.path.join(os.path.dirname(__file__), README_FILENAME)) long_description = readme.read() readme.close() setup( name='django-cbv-formpreview', version=VERSION, author='Ryan Kaskel', author_email='[email protected]', url='https://github.com/ryankask/django-cbv-formpreview', license='BSD', description='Django\'s FormPreview updated to use class based views.', long_description=long_description, packages=find_packages(), package_data = { 'cbv_formpreview': ['templates/*.html', 'templates/formtools/*.html'] }, zip_safe=False, classifiers=[ 'Environment :: Web Environment', 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Framework :: Django', ], test_suite='cbv_formpreview.tests.runtests.runtests' ) Update package data and version number.
import os from setuptools import setup, find_packages VERSION = '0.2.0a1' README_FILENAME = 'README.rst' readme = open(os.path.join(os.path.dirname(__file__), README_FILENAME)) long_description = readme.read() readme.close() setup( name='django-cbv-formpreview', version=VERSION, author='Ryan Kaskel', author_email='[email protected]', url='https://github.com/ryankask/django-cbv-formpreview', license='BSD', description='Django\'s FormPreview updated to use class based views.', long_description=long_description, packages=find_packages(), package_data = { 'cbv_formpreview': ['templates/cbv_formpreview/*.html'] }, zip_safe=False, classifiers=[ 'Environment :: Web Environment', 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Framework :: Django', ], test_suite='cbv_formpreview.tests.runtests.runtests' )
<commit_before>import os from setuptools import setup, find_packages VERSION = '0.1.3a1' README_FILENAME = 'README.rst' readme = open(os.path.join(os.path.dirname(__file__), README_FILENAME)) long_description = readme.read() readme.close() setup( name='django-cbv-formpreview', version=VERSION, author='Ryan Kaskel', author_email='[email protected]', url='https://github.com/ryankask/django-cbv-formpreview', license='BSD', description='Django\'s FormPreview updated to use class based views.', long_description=long_description, packages=find_packages(), package_data = { 'cbv_formpreview': ['templates/*.html', 'templates/formtools/*.html'] }, zip_safe=False, classifiers=[ 'Environment :: Web Environment', 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Framework :: Django', ], test_suite='cbv_formpreview.tests.runtests.runtests' ) <commit_msg>Update package data and version number.<commit_after>
import os from setuptools import setup, find_packages VERSION = '0.2.0a1' README_FILENAME = 'README.rst' readme = open(os.path.join(os.path.dirname(__file__), README_FILENAME)) long_description = readme.read() readme.close() setup( name='django-cbv-formpreview', version=VERSION, author='Ryan Kaskel', author_email='[email protected]', url='https://github.com/ryankask/django-cbv-formpreview', license='BSD', description='Django\'s FormPreview updated to use class based views.', long_description=long_description, packages=find_packages(), package_data = { 'cbv_formpreview': ['templates/cbv_formpreview/*.html'] }, zip_safe=False, classifiers=[ 'Environment :: Web Environment', 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Framework :: Django', ], test_suite='cbv_formpreview.tests.runtests.runtests' )
import os from setuptools import setup, find_packages VERSION = '0.1.3a1' README_FILENAME = 'README.rst' readme = open(os.path.join(os.path.dirname(__file__), README_FILENAME)) long_description = readme.read() readme.close() setup( name='django-cbv-formpreview', version=VERSION, author='Ryan Kaskel', author_email='[email protected]', url='https://github.com/ryankask/django-cbv-formpreview', license='BSD', description='Django\'s FormPreview updated to use class based views.', long_description=long_description, packages=find_packages(), package_data = { 'cbv_formpreview': ['templates/*.html', 'templates/formtools/*.html'] }, zip_safe=False, classifiers=[ 'Environment :: Web Environment', 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Framework :: Django', ], test_suite='cbv_formpreview.tests.runtests.runtests' ) Update package data and version number.import os from setuptools import setup, find_packages VERSION = '0.2.0a1' README_FILENAME = 'README.rst' readme = open(os.path.join(os.path.dirname(__file__), README_FILENAME)) long_description = readme.read() readme.close() setup( name='django-cbv-formpreview', version=VERSION, author='Ryan Kaskel', author_email='[email protected]', url='https://github.com/ryankask/django-cbv-formpreview', license='BSD', description='Django\'s FormPreview updated to use class based views.', long_description=long_description, packages=find_packages(), package_data = { 'cbv_formpreview': ['templates/cbv_formpreview/*.html'] }, zip_safe=False, classifiers=[ 'Environment :: Web Environment', 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Framework :: Django', ], test_suite='cbv_formpreview.tests.runtests.runtests' )
<commit_before>import os from setuptools import setup, find_packages VERSION = '0.1.3a1' README_FILENAME = 'README.rst' readme = open(os.path.join(os.path.dirname(__file__), README_FILENAME)) long_description = readme.read() readme.close() setup( name='django-cbv-formpreview', version=VERSION, author='Ryan Kaskel', author_email='[email protected]', url='https://github.com/ryankask/django-cbv-formpreview', license='BSD', description='Django\'s FormPreview updated to use class based views.', long_description=long_description, packages=find_packages(), package_data = { 'cbv_formpreview': ['templates/*.html', 'templates/formtools/*.html'] }, zip_safe=False, classifiers=[ 'Environment :: Web Environment', 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Framework :: Django', ], test_suite='cbv_formpreview.tests.runtests.runtests' ) <commit_msg>Update package data and version number.<commit_after>import os from setuptools import setup, find_packages VERSION = '0.2.0a1' README_FILENAME = 'README.rst' readme = open(os.path.join(os.path.dirname(__file__), README_FILENAME)) long_description = readme.read() readme.close() setup( name='django-cbv-formpreview', version=VERSION, author='Ryan Kaskel', author_email='[email protected]', url='https://github.com/ryankask/django-cbv-formpreview', license='BSD', description='Django\'s FormPreview updated to use class based views.', long_description=long_description, packages=find_packages(), package_data = { 'cbv_formpreview': ['templates/cbv_formpreview/*.html'] }, zip_safe=False, classifiers=[ 'Environment :: Web Environment', 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Framework :: Django', ], test_suite='cbv_formpreview.tests.runtests.runtests' )
0bf7b654f1e1b6191e515e718911f027ea110ee3
setup.py
setup.py
# -*- coding: utf-8 -*- import os from setuptools import setup from setuptools.dist import Distribution with open(os.path.join(os.path.dirname(__file__), 'README')) as f: doc = f.read() class BinaryDistribution(Distribution): def is_pure(self): return False setup( name='json-stream', version='1.0.1', url='http://fireteam.net/', license='BSD', author='Fireteam Ltd.', author_email='[email protected]', description='A small wrapper around YAJL\'s lexer', long_description=doc, classifiers=[ 'Development Status :: 5 - Production/Stable', 'Environment :: Web Environment', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Programming Language :: Python', ], packages=['jsonstream'], include_package_data=True, distclass=BinaryDistribution, )
# -*- coding: utf-8 -*- import os from setuptools import setup from setuptools.dist import Distribution with open(os.path.join(os.path.dirname(__file__), 'README')) as f: doc = f.read() class BinaryDistribution(Distribution): def is_pure(self): return False setup( name='json-stream', version='1.0.1', url='https://github.com/fireteam/python-json-stream', license='BSD', author='Fireteam Ltd.', author_email='[email protected]', description='A small wrapper around YAJL\'s lexer', long_description=doc, classifiers=[ 'Development Status :: 5 - Production/Stable', 'Environment :: Web Environment', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Programming Language :: Python', ], packages=['jsonstream'], include_package_data=True, distclass=BinaryDistribution, )
Set URL to github one.
Set URL to github one.
Python
bsd-3-clause
fireteam/python-json-stream
# -*- coding: utf-8 -*- import os from setuptools import setup from setuptools.dist import Distribution with open(os.path.join(os.path.dirname(__file__), 'README')) as f: doc = f.read() class BinaryDistribution(Distribution): def is_pure(self): return False setup( name='json-stream', version='1.0.1', url='http://fireteam.net/', license='BSD', author='Fireteam Ltd.', author_email='[email protected]', description='A small wrapper around YAJL\'s lexer', long_description=doc, classifiers=[ 'Development Status :: 5 - Production/Stable', 'Environment :: Web Environment', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Programming Language :: Python', ], packages=['jsonstream'], include_package_data=True, distclass=BinaryDistribution, ) Set URL to github one.
# -*- coding: utf-8 -*- import os from setuptools import setup from setuptools.dist import Distribution with open(os.path.join(os.path.dirname(__file__), 'README')) as f: doc = f.read() class BinaryDistribution(Distribution): def is_pure(self): return False setup( name='json-stream', version='1.0.1', url='https://github.com/fireteam/python-json-stream', license='BSD', author='Fireteam Ltd.', author_email='[email protected]', description='A small wrapper around YAJL\'s lexer', long_description=doc, classifiers=[ 'Development Status :: 5 - Production/Stable', 'Environment :: Web Environment', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Programming Language :: Python', ], packages=['jsonstream'], include_package_data=True, distclass=BinaryDistribution, )
<commit_before># -*- coding: utf-8 -*- import os from setuptools import setup from setuptools.dist import Distribution with open(os.path.join(os.path.dirname(__file__), 'README')) as f: doc = f.read() class BinaryDistribution(Distribution): def is_pure(self): return False setup( name='json-stream', version='1.0.1', url='http://fireteam.net/', license='BSD', author='Fireteam Ltd.', author_email='[email protected]', description='A small wrapper around YAJL\'s lexer', long_description=doc, classifiers=[ 'Development Status :: 5 - Production/Stable', 'Environment :: Web Environment', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Programming Language :: Python', ], packages=['jsonstream'], include_package_data=True, distclass=BinaryDistribution, ) <commit_msg>Set URL to github one.<commit_after>
# -*- coding: utf-8 -*- import os from setuptools import setup from setuptools.dist import Distribution with open(os.path.join(os.path.dirname(__file__), 'README')) as f: doc = f.read() class BinaryDistribution(Distribution): def is_pure(self): return False setup( name='json-stream', version='1.0.1', url='https://github.com/fireteam/python-json-stream', license='BSD', author='Fireteam Ltd.', author_email='[email protected]', description='A small wrapper around YAJL\'s lexer', long_description=doc, classifiers=[ 'Development Status :: 5 - Production/Stable', 'Environment :: Web Environment', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Programming Language :: Python', ], packages=['jsonstream'], include_package_data=True, distclass=BinaryDistribution, )
# -*- coding: utf-8 -*- import os from setuptools import setup from setuptools.dist import Distribution with open(os.path.join(os.path.dirname(__file__), 'README')) as f: doc = f.read() class BinaryDistribution(Distribution): def is_pure(self): return False setup( name='json-stream', version='1.0.1', url='http://fireteam.net/', license='BSD', author='Fireteam Ltd.', author_email='[email protected]', description='A small wrapper around YAJL\'s lexer', long_description=doc, classifiers=[ 'Development Status :: 5 - Production/Stable', 'Environment :: Web Environment', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Programming Language :: Python', ], packages=['jsonstream'], include_package_data=True, distclass=BinaryDistribution, ) Set URL to github one.# -*- coding: utf-8 -*- import os from setuptools import setup from setuptools.dist import Distribution with open(os.path.join(os.path.dirname(__file__), 'README')) as f: doc = f.read() class BinaryDistribution(Distribution): def is_pure(self): return False setup( name='json-stream', version='1.0.1', url='https://github.com/fireteam/python-json-stream', license='BSD', author='Fireteam Ltd.', author_email='[email protected]', description='A small wrapper around YAJL\'s lexer', long_description=doc, classifiers=[ 'Development Status :: 5 - Production/Stable', 'Environment :: Web Environment', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Programming Language :: Python', ], packages=['jsonstream'], include_package_data=True, distclass=BinaryDistribution, )
<commit_before># -*- coding: utf-8 -*- import os from setuptools import setup from setuptools.dist import Distribution with open(os.path.join(os.path.dirname(__file__), 'README')) as f: doc = f.read() class BinaryDistribution(Distribution): def is_pure(self): return False setup( name='json-stream', version='1.0.1', url='http://fireteam.net/', license='BSD', author='Fireteam Ltd.', author_email='[email protected]', description='A small wrapper around YAJL\'s lexer', long_description=doc, classifiers=[ 'Development Status :: 5 - Production/Stable', 'Environment :: Web Environment', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Programming Language :: Python', ], packages=['jsonstream'], include_package_data=True, distclass=BinaryDistribution, ) <commit_msg>Set URL to github one.<commit_after># -*- coding: utf-8 -*- import os from setuptools import setup from setuptools.dist import Distribution with open(os.path.join(os.path.dirname(__file__), 'README')) as f: doc = f.read() class BinaryDistribution(Distribution): def is_pure(self): return False setup( name='json-stream', version='1.0.1', url='https://github.com/fireteam/python-json-stream', license='BSD', author='Fireteam Ltd.', author_email='[email protected]', description='A small wrapper around YAJL\'s lexer', long_description=doc, classifiers=[ 'Development Status :: 5 - Production/Stable', 'Environment :: Web Environment', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Programming Language :: Python', ], packages=['jsonstream'], include_package_data=True, distclass=BinaryDistribution, )
8e9be2dedf41607c3928c8aa1f49a59989b3380a
setup.py
setup.py
from setuptools import setup, find_packages from lighthouse import __version__ classifiers = [] with open("classifiers.txt") as fd: classifiers = fd.readlines() setup( name="lighthouse", version=__version__, description="Service discovery tool focused on ease-of-use and resiliency", author="William Glass", author_email="[email protected]", url="http://github.com/wglass/lighthouse", license="MIT", classifiers=classifiers, packages=find_packages(exclude=["tests", "tests.*"]), include_package_data=True, package_data={ "lighthouse": ["haproxy/*.json"], }, install_requires=[ "watchdog", "pyyaml", "kazoo", "six", ], extras_require={ "redis": [ "redis" ] }, entry_points={ "console_scripts": [ "lighthouse-reporter = lighthouse.scripts.reporter:run", "lighthouse-writer = lighthouse.scripts.writer:run" ], "lighthouse.balancers": [ "haproxy = lighthouse.haproxy.balancer:HAProxy", ], "lighthouse.discovery": [ "zookeeper = lighthouse.zookeeper:ZookeeperDiscovery", ], "lighthouse.checks": [ "http = lighthouse.checks.http:HTTPCheck", "redis = lighthouse.redis.check:RedisCheck [redis]", ] }, tests_require=[ "nose", "mock", "coverage", "flake8", ], )
from setuptools import setup, find_packages from lighthouse import __version__ classifiers = [] with open("classifiers.txt") as fd: classifiers = fd.readlines() setup( name="lighthouse", version=__version__, description="Service discovery tool focused on ease-of-use and resiliency", author="William Glass", author_email="[email protected]", url="http://github.com/wglass/lighthouse", license="MIT", classifiers=classifiers, packages=find_packages(exclude=["tests", "tests.*"]), include_package_data=True, package_data={ "lighthouse": ["haproxy/*.json"], }, install_requires=[ "watchdog", "pyyaml", "kazoo", "six", ], extras_require={ "redis": [ "redis" ] }, entry_points={ "console_scripts": [ "lighthouse-reporter = lighthouse.scripts.reporter:run", "lighthouse-writer = lighthouse.scripts.writer:run" ], "lighthouse.coordinators": [ "haproxy = lighthouse.haproxy.coordinator:HAProxy", ], "lighthouse.discovery": [ "zookeeper = lighthouse.zookeeper:ZookeeperDiscovery", ], "lighthouse.checks": [ "http = lighthouse.checks.http:HTTPCheck", "redis = lighthouse.redis.check:RedisCheck [redis]", ] }, tests_require=[ "nose", "mock", "coverage", "flake8", ], )
Update balancers entry point to be coordinators.
Update balancers entry point to be coordinators.
Python
apache-2.0
wglass/lighthouse
from setuptools import setup, find_packages from lighthouse import __version__ classifiers = [] with open("classifiers.txt") as fd: classifiers = fd.readlines() setup( name="lighthouse", version=__version__, description="Service discovery tool focused on ease-of-use and resiliency", author="William Glass", author_email="[email protected]", url="http://github.com/wglass/lighthouse", license="MIT", classifiers=classifiers, packages=find_packages(exclude=["tests", "tests.*"]), include_package_data=True, package_data={ "lighthouse": ["haproxy/*.json"], }, install_requires=[ "watchdog", "pyyaml", "kazoo", "six", ], extras_require={ "redis": [ "redis" ] }, entry_points={ "console_scripts": [ "lighthouse-reporter = lighthouse.scripts.reporter:run", "lighthouse-writer = lighthouse.scripts.writer:run" ], "lighthouse.balancers": [ "haproxy = lighthouse.haproxy.balancer:HAProxy", ], "lighthouse.discovery": [ "zookeeper = lighthouse.zookeeper:ZookeeperDiscovery", ], "lighthouse.checks": [ "http = lighthouse.checks.http:HTTPCheck", "redis = lighthouse.redis.check:RedisCheck [redis]", ] }, tests_require=[ "nose", "mock", "coverage", "flake8", ], ) Update balancers entry point to be coordinators.
from setuptools import setup, find_packages from lighthouse import __version__ classifiers = [] with open("classifiers.txt") as fd: classifiers = fd.readlines() setup( name="lighthouse", version=__version__, description="Service discovery tool focused on ease-of-use and resiliency", author="William Glass", author_email="[email protected]", url="http://github.com/wglass/lighthouse", license="MIT", classifiers=classifiers, packages=find_packages(exclude=["tests", "tests.*"]), include_package_data=True, package_data={ "lighthouse": ["haproxy/*.json"], }, install_requires=[ "watchdog", "pyyaml", "kazoo", "six", ], extras_require={ "redis": [ "redis" ] }, entry_points={ "console_scripts": [ "lighthouse-reporter = lighthouse.scripts.reporter:run", "lighthouse-writer = lighthouse.scripts.writer:run" ], "lighthouse.coordinators": [ "haproxy = lighthouse.haproxy.coordinator:HAProxy", ], "lighthouse.discovery": [ "zookeeper = lighthouse.zookeeper:ZookeeperDiscovery", ], "lighthouse.checks": [ "http = lighthouse.checks.http:HTTPCheck", "redis = lighthouse.redis.check:RedisCheck [redis]", ] }, tests_require=[ "nose", "mock", "coverage", "flake8", ], )
<commit_before>from setuptools import setup, find_packages from lighthouse import __version__ classifiers = [] with open("classifiers.txt") as fd: classifiers = fd.readlines() setup( name="lighthouse", version=__version__, description="Service discovery tool focused on ease-of-use and resiliency", author="William Glass", author_email="[email protected]", url="http://github.com/wglass/lighthouse", license="MIT", classifiers=classifiers, packages=find_packages(exclude=["tests", "tests.*"]), include_package_data=True, package_data={ "lighthouse": ["haproxy/*.json"], }, install_requires=[ "watchdog", "pyyaml", "kazoo", "six", ], extras_require={ "redis": [ "redis" ] }, entry_points={ "console_scripts": [ "lighthouse-reporter = lighthouse.scripts.reporter:run", "lighthouse-writer = lighthouse.scripts.writer:run" ], "lighthouse.balancers": [ "haproxy = lighthouse.haproxy.balancer:HAProxy", ], "lighthouse.discovery": [ "zookeeper = lighthouse.zookeeper:ZookeeperDiscovery", ], "lighthouse.checks": [ "http = lighthouse.checks.http:HTTPCheck", "redis = lighthouse.redis.check:RedisCheck [redis]", ] }, tests_require=[ "nose", "mock", "coverage", "flake8", ], ) <commit_msg>Update balancers entry point to be coordinators.<commit_after>
from setuptools import setup, find_packages from lighthouse import __version__ classifiers = [] with open("classifiers.txt") as fd: classifiers = fd.readlines() setup( name="lighthouse", version=__version__, description="Service discovery tool focused on ease-of-use and resiliency", author="William Glass", author_email="[email protected]", url="http://github.com/wglass/lighthouse", license="MIT", classifiers=classifiers, packages=find_packages(exclude=["tests", "tests.*"]), include_package_data=True, package_data={ "lighthouse": ["haproxy/*.json"], }, install_requires=[ "watchdog", "pyyaml", "kazoo", "six", ], extras_require={ "redis": [ "redis" ] }, entry_points={ "console_scripts": [ "lighthouse-reporter = lighthouse.scripts.reporter:run", "lighthouse-writer = lighthouse.scripts.writer:run" ], "lighthouse.coordinators": [ "haproxy = lighthouse.haproxy.coordinator:HAProxy", ], "lighthouse.discovery": [ "zookeeper = lighthouse.zookeeper:ZookeeperDiscovery", ], "lighthouse.checks": [ "http = lighthouse.checks.http:HTTPCheck", "redis = lighthouse.redis.check:RedisCheck [redis]", ] }, tests_require=[ "nose", "mock", "coverage", "flake8", ], )
from setuptools import setup, find_packages from lighthouse import __version__ classifiers = [] with open("classifiers.txt") as fd: classifiers = fd.readlines() setup( name="lighthouse", version=__version__, description="Service discovery tool focused on ease-of-use and resiliency", author="William Glass", author_email="[email protected]", url="http://github.com/wglass/lighthouse", license="MIT", classifiers=classifiers, packages=find_packages(exclude=["tests", "tests.*"]), include_package_data=True, package_data={ "lighthouse": ["haproxy/*.json"], }, install_requires=[ "watchdog", "pyyaml", "kazoo", "six", ], extras_require={ "redis": [ "redis" ] }, entry_points={ "console_scripts": [ "lighthouse-reporter = lighthouse.scripts.reporter:run", "lighthouse-writer = lighthouse.scripts.writer:run" ], "lighthouse.balancers": [ "haproxy = lighthouse.haproxy.balancer:HAProxy", ], "lighthouse.discovery": [ "zookeeper = lighthouse.zookeeper:ZookeeperDiscovery", ], "lighthouse.checks": [ "http = lighthouse.checks.http:HTTPCheck", "redis = lighthouse.redis.check:RedisCheck [redis]", ] }, tests_require=[ "nose", "mock", "coverage", "flake8", ], ) Update balancers entry point to be coordinators.from setuptools import setup, find_packages from lighthouse import __version__ classifiers = [] with open("classifiers.txt") as fd: classifiers = fd.readlines() setup( name="lighthouse", version=__version__, description="Service discovery tool focused on ease-of-use and resiliency", author="William Glass", author_email="[email protected]", url="http://github.com/wglass/lighthouse", license="MIT", classifiers=classifiers, packages=find_packages(exclude=["tests", "tests.*"]), include_package_data=True, package_data={ "lighthouse": ["haproxy/*.json"], }, install_requires=[ "watchdog", "pyyaml", "kazoo", "six", ], extras_require={ "redis": [ "redis" ] }, entry_points={ "console_scripts": [ "lighthouse-reporter = lighthouse.scripts.reporter:run", "lighthouse-writer = lighthouse.scripts.writer:run" ], "lighthouse.coordinators": [ "haproxy = lighthouse.haproxy.coordinator:HAProxy", ], "lighthouse.discovery": [ "zookeeper = lighthouse.zookeeper:ZookeeperDiscovery", ], "lighthouse.checks": [ "http = lighthouse.checks.http:HTTPCheck", "redis = lighthouse.redis.check:RedisCheck [redis]", ] }, tests_require=[ "nose", "mock", "coverage", "flake8", ], )
<commit_before>from setuptools import setup, find_packages from lighthouse import __version__ classifiers = [] with open("classifiers.txt") as fd: classifiers = fd.readlines() setup( name="lighthouse", version=__version__, description="Service discovery tool focused on ease-of-use and resiliency", author="William Glass", author_email="[email protected]", url="http://github.com/wglass/lighthouse", license="MIT", classifiers=classifiers, packages=find_packages(exclude=["tests", "tests.*"]), include_package_data=True, package_data={ "lighthouse": ["haproxy/*.json"], }, install_requires=[ "watchdog", "pyyaml", "kazoo", "six", ], extras_require={ "redis": [ "redis" ] }, entry_points={ "console_scripts": [ "lighthouse-reporter = lighthouse.scripts.reporter:run", "lighthouse-writer = lighthouse.scripts.writer:run" ], "lighthouse.balancers": [ "haproxy = lighthouse.haproxy.balancer:HAProxy", ], "lighthouse.discovery": [ "zookeeper = lighthouse.zookeeper:ZookeeperDiscovery", ], "lighthouse.checks": [ "http = lighthouse.checks.http:HTTPCheck", "redis = lighthouse.redis.check:RedisCheck [redis]", ] }, tests_require=[ "nose", "mock", "coverage", "flake8", ], ) <commit_msg>Update balancers entry point to be coordinators.<commit_after>from setuptools import setup, find_packages from lighthouse import __version__ classifiers = [] with open("classifiers.txt") as fd: classifiers = fd.readlines() setup( name="lighthouse", version=__version__, description="Service discovery tool focused on ease-of-use and resiliency", author="William Glass", author_email="[email protected]", url="http://github.com/wglass/lighthouse", license="MIT", classifiers=classifiers, packages=find_packages(exclude=["tests", "tests.*"]), include_package_data=True, package_data={ "lighthouse": ["haproxy/*.json"], }, install_requires=[ "watchdog", "pyyaml", "kazoo", "six", ], extras_require={ "redis": [ "redis" ] }, entry_points={ "console_scripts": [ "lighthouse-reporter = lighthouse.scripts.reporter:run", "lighthouse-writer = lighthouse.scripts.writer:run" ], "lighthouse.coordinators": [ "haproxy = lighthouse.haproxy.coordinator:HAProxy", ], "lighthouse.discovery": [ "zookeeper = lighthouse.zookeeper:ZookeeperDiscovery", ], "lighthouse.checks": [ "http = lighthouse.checks.http:HTTPCheck", "redis = lighthouse.redis.check:RedisCheck [redis]", ] }, tests_require=[ "nose", "mock", "coverage", "flake8", ], )
9e548d0ac9bb953e4ecc27321d4455d27f653467
setup.py
setup.py
from setuptools import setup, find_packages setup( name='tangled.auth', version='0.1a2.dev0', description='Tangled auth integration', long_description=open('README.rst').read(), url='http://tangledframework.org/', author='Wyatt Baldwin', author_email='[email protected]', packages=find_packages(), install_requires=( 'tangled.web>=0.1.dev0', ), extras_require={ 'dev': ( 'tangled[dev]', ), }, entry_points=""" [tangled.scripts] auth = tangled.auth.command:Command """, classifiers=( 'Development Status :: 1 - Planning', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python :: 3', ), )
from setuptools import setup setup( name='tangled.auth', version='0.1a2.dev0', description='Tangled auth integration', long_description=open('README.rst').read(), url='http://tangledframework.org/', author='Wyatt Baldwin', author_email='[email protected]', packages=[ 'tangled.auth', 'tangled.auth.tests', ], install_requires=[ 'tangled.web>=0.1.dev0', ], extras_require={ 'dev': [ 'tangled[dev]', ], }, entry_points=""" [tangled.scripts] auth = tangled.auth.command:Command """, classifiers=[ 'Development Status :: 1 - Planning', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python :: 3', ], )
Update package configuration, pt. ii
Update package configuration, pt. ii
Python
mit
TangledWeb/tangled.auth
from setuptools import setup, find_packages setup( name='tangled.auth', version='0.1a2.dev0', description='Tangled auth integration', long_description=open('README.rst').read(), url='http://tangledframework.org/', author='Wyatt Baldwin', author_email='[email protected]', packages=find_packages(), install_requires=( 'tangled.web>=0.1.dev0', ), extras_require={ 'dev': ( 'tangled[dev]', ), }, entry_points=""" [tangled.scripts] auth = tangled.auth.command:Command """, classifiers=( 'Development Status :: 1 - Planning', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python :: 3', ), ) Update package configuration, pt. ii
from setuptools import setup setup( name='tangled.auth', version='0.1a2.dev0', description='Tangled auth integration', long_description=open('README.rst').read(), url='http://tangledframework.org/', author='Wyatt Baldwin', author_email='[email protected]', packages=[ 'tangled.auth', 'tangled.auth.tests', ], install_requires=[ 'tangled.web>=0.1.dev0', ], extras_require={ 'dev': [ 'tangled[dev]', ], }, entry_points=""" [tangled.scripts] auth = tangled.auth.command:Command """, classifiers=[ 'Development Status :: 1 - Planning', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python :: 3', ], )
<commit_before>from setuptools import setup, find_packages setup( name='tangled.auth', version='0.1a2.dev0', description='Tangled auth integration', long_description=open('README.rst').read(), url='http://tangledframework.org/', author='Wyatt Baldwin', author_email='[email protected]', packages=find_packages(), install_requires=( 'tangled.web>=0.1.dev0', ), extras_require={ 'dev': ( 'tangled[dev]', ), }, entry_points=""" [tangled.scripts] auth = tangled.auth.command:Command """, classifiers=( 'Development Status :: 1 - Planning', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python :: 3', ), ) <commit_msg>Update package configuration, pt. ii<commit_after>
from setuptools import setup setup( name='tangled.auth', version='0.1a2.dev0', description='Tangled auth integration', long_description=open('README.rst').read(), url='http://tangledframework.org/', author='Wyatt Baldwin', author_email='[email protected]', packages=[ 'tangled.auth', 'tangled.auth.tests', ], install_requires=[ 'tangled.web>=0.1.dev0', ], extras_require={ 'dev': [ 'tangled[dev]', ], }, entry_points=""" [tangled.scripts] auth = tangled.auth.command:Command """, classifiers=[ 'Development Status :: 1 - Planning', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python :: 3', ], )
from setuptools import setup, find_packages setup( name='tangled.auth', version='0.1a2.dev0', description='Tangled auth integration', long_description=open('README.rst').read(), url='http://tangledframework.org/', author='Wyatt Baldwin', author_email='[email protected]', packages=find_packages(), install_requires=( 'tangled.web>=0.1.dev0', ), extras_require={ 'dev': ( 'tangled[dev]', ), }, entry_points=""" [tangled.scripts] auth = tangled.auth.command:Command """, classifiers=( 'Development Status :: 1 - Planning', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python :: 3', ), ) Update package configuration, pt. iifrom setuptools import setup setup( name='tangled.auth', version='0.1a2.dev0', description='Tangled auth integration', long_description=open('README.rst').read(), url='http://tangledframework.org/', author='Wyatt Baldwin', author_email='[email protected]', packages=[ 'tangled.auth', 'tangled.auth.tests', ], install_requires=[ 'tangled.web>=0.1.dev0', ], extras_require={ 'dev': [ 'tangled[dev]', ], }, entry_points=""" [tangled.scripts] auth = tangled.auth.command:Command """, classifiers=[ 'Development Status :: 1 - Planning', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python :: 3', ], )
<commit_before>from setuptools import setup, find_packages setup( name='tangled.auth', version='0.1a2.dev0', description='Tangled auth integration', long_description=open('README.rst').read(), url='http://tangledframework.org/', author='Wyatt Baldwin', author_email='[email protected]', packages=find_packages(), install_requires=( 'tangled.web>=0.1.dev0', ), extras_require={ 'dev': ( 'tangled[dev]', ), }, entry_points=""" [tangled.scripts] auth = tangled.auth.command:Command """, classifiers=( 'Development Status :: 1 - Planning', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python :: 3', ), ) <commit_msg>Update package configuration, pt. ii<commit_after>from setuptools import setup setup( name='tangled.auth', version='0.1a2.dev0', description='Tangled auth integration', long_description=open('README.rst').read(), url='http://tangledframework.org/', author='Wyatt Baldwin', author_email='[email protected]', packages=[ 'tangled.auth', 'tangled.auth.tests', ], install_requires=[ 'tangled.web>=0.1.dev0', ], extras_require={ 'dev': [ 'tangled[dev]', ], }, entry_points=""" [tangled.scripts] auth = tangled.auth.command:Command """, classifiers=[ 'Development Status :: 1 - Planning', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python :: 3', ], )
f74f517a75fcf9f6858cc37823a19970cb27bd54
setup.py
setup.py
#!/usr/bin/env python import re from codecs import open from setuptools import setup with open('README.rst', encoding='utf8') as readme_file: readme = readme_file.read() with open('maxmindupdater/__init__.py', encoding='utf8') as init_py: metadata = dict(re.findall(r"__([a-z]+)__ = '([^']+)'", init_py.read())) setup( name='maxmindupdater', version=metadata['version'], description=metadata['doc'], long_description=readme, author='Yola', author_email='[email protected]', license='MIT (Expat)', url=metadata['doc'], packages=['maxmindupdater'], test_suite='nose.collector', entry_points={ 'console_scripts': ['maxmind-updater=maxmindupdater.__main__:main'], }, install_requires=[ 'requests >= 2.0.0, < 3.0.0', 'maxminddb >= 1.0.0, < 2.0.0' ], classifiers=[ 'License :: OSI Approved :: MIT License', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', ], )
#!/usr/bin/env python import re from codecs import open from setuptools import setup with open('README.rst', encoding='utf8') as readme_file: readme = readme_file.read() with open('maxmindupdater/__init__.py', encoding='utf8') as init_py: metadata = dict(re.findall(r"__([a-z]+)__ = '([^']+)'", init_py.read())) setup( name='maxmindupdater', version=metadata['version'], description=metadata['doc'], long_description=readme, author='Yola', author_email='[email protected]', license='MIT (Expat)', url=metadata['doc'], packages=['maxmindupdater'], test_suite='nose.collector', entry_points={ 'console_scripts': ['maxmind-updater=maxmindupdater.__main__:main'], }, install_requires=[ 'requests >= 2.0.0, < 3.0.0', 'maxminddb >= 1.0.0, < 2.0.0' ], classifiers=[ 'License :: OSI Approved :: MIT License', 'Programming Language :: Python', 'Programming Language :: Python :: 2', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', ], )
Include more general python classifiers for searchability
Include more general python classifiers for searchability
Python
mit
yola/maxmind-updater,yola/maxmind-updater
#!/usr/bin/env python import re from codecs import open from setuptools import setup with open('README.rst', encoding='utf8') as readme_file: readme = readme_file.read() with open('maxmindupdater/__init__.py', encoding='utf8') as init_py: metadata = dict(re.findall(r"__([a-z]+)__ = '([^']+)'", init_py.read())) setup( name='maxmindupdater', version=metadata['version'], description=metadata['doc'], long_description=readme, author='Yola', author_email='[email protected]', license='MIT (Expat)', url=metadata['doc'], packages=['maxmindupdater'], test_suite='nose.collector', entry_points={ 'console_scripts': ['maxmind-updater=maxmindupdater.__main__:main'], }, install_requires=[ 'requests >= 2.0.0, < 3.0.0', 'maxminddb >= 1.0.0, < 2.0.0' ], classifiers=[ 'License :: OSI Approved :: MIT License', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', ], ) Include more general python classifiers for searchability
#!/usr/bin/env python import re from codecs import open from setuptools import setup with open('README.rst', encoding='utf8') as readme_file: readme = readme_file.read() with open('maxmindupdater/__init__.py', encoding='utf8') as init_py: metadata = dict(re.findall(r"__([a-z]+)__ = '([^']+)'", init_py.read())) setup( name='maxmindupdater', version=metadata['version'], description=metadata['doc'], long_description=readme, author='Yola', author_email='[email protected]', license='MIT (Expat)', url=metadata['doc'], packages=['maxmindupdater'], test_suite='nose.collector', entry_points={ 'console_scripts': ['maxmind-updater=maxmindupdater.__main__:main'], }, install_requires=[ 'requests >= 2.0.0, < 3.0.0', 'maxminddb >= 1.0.0, < 2.0.0' ], classifiers=[ 'License :: OSI Approved :: MIT License', 'Programming Language :: Python', 'Programming Language :: Python :: 2', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', ], )
<commit_before>#!/usr/bin/env python import re from codecs import open from setuptools import setup with open('README.rst', encoding='utf8') as readme_file: readme = readme_file.read() with open('maxmindupdater/__init__.py', encoding='utf8') as init_py: metadata = dict(re.findall(r"__([a-z]+)__ = '([^']+)'", init_py.read())) setup( name='maxmindupdater', version=metadata['version'], description=metadata['doc'], long_description=readme, author='Yola', author_email='[email protected]', license='MIT (Expat)', url=metadata['doc'], packages=['maxmindupdater'], test_suite='nose.collector', entry_points={ 'console_scripts': ['maxmind-updater=maxmindupdater.__main__:main'], }, install_requires=[ 'requests >= 2.0.0, < 3.0.0', 'maxminddb >= 1.0.0, < 2.0.0' ], classifiers=[ 'License :: OSI Approved :: MIT License', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', ], ) <commit_msg>Include more general python classifiers for searchability<commit_after>
#!/usr/bin/env python import re from codecs import open from setuptools import setup with open('README.rst', encoding='utf8') as readme_file: readme = readme_file.read() with open('maxmindupdater/__init__.py', encoding='utf8') as init_py: metadata = dict(re.findall(r"__([a-z]+)__ = '([^']+)'", init_py.read())) setup( name='maxmindupdater', version=metadata['version'], description=metadata['doc'], long_description=readme, author='Yola', author_email='[email protected]', license='MIT (Expat)', url=metadata['doc'], packages=['maxmindupdater'], test_suite='nose.collector', entry_points={ 'console_scripts': ['maxmind-updater=maxmindupdater.__main__:main'], }, install_requires=[ 'requests >= 2.0.0, < 3.0.0', 'maxminddb >= 1.0.0, < 2.0.0' ], classifiers=[ 'License :: OSI Approved :: MIT License', 'Programming Language :: Python', 'Programming Language :: Python :: 2', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', ], )
#!/usr/bin/env python import re from codecs import open from setuptools import setup with open('README.rst', encoding='utf8') as readme_file: readme = readme_file.read() with open('maxmindupdater/__init__.py', encoding='utf8') as init_py: metadata = dict(re.findall(r"__([a-z]+)__ = '([^']+)'", init_py.read())) setup( name='maxmindupdater', version=metadata['version'], description=metadata['doc'], long_description=readme, author='Yola', author_email='[email protected]', license='MIT (Expat)', url=metadata['doc'], packages=['maxmindupdater'], test_suite='nose.collector', entry_points={ 'console_scripts': ['maxmind-updater=maxmindupdater.__main__:main'], }, install_requires=[ 'requests >= 2.0.0, < 3.0.0', 'maxminddb >= 1.0.0, < 2.0.0' ], classifiers=[ 'License :: OSI Approved :: MIT License', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', ], ) Include more general python classifiers for searchability#!/usr/bin/env python import re from codecs import open from setuptools import setup with open('README.rst', encoding='utf8') as readme_file: readme = readme_file.read() with open('maxmindupdater/__init__.py', encoding='utf8') as init_py: metadata = dict(re.findall(r"__([a-z]+)__ = '([^']+)'", init_py.read())) setup( name='maxmindupdater', version=metadata['version'], description=metadata['doc'], long_description=readme, author='Yola', author_email='[email protected]', license='MIT (Expat)', url=metadata['doc'], packages=['maxmindupdater'], test_suite='nose.collector', entry_points={ 'console_scripts': ['maxmind-updater=maxmindupdater.__main__:main'], }, install_requires=[ 'requests >= 2.0.0, < 3.0.0', 'maxminddb >= 1.0.0, < 2.0.0' ], classifiers=[ 'License :: OSI Approved :: MIT License', 'Programming Language :: Python', 'Programming Language :: Python :: 2', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', ], )
<commit_before>#!/usr/bin/env python import re from codecs import open from setuptools import setup with open('README.rst', encoding='utf8') as readme_file: readme = readme_file.read() with open('maxmindupdater/__init__.py', encoding='utf8') as init_py: metadata = dict(re.findall(r"__([a-z]+)__ = '([^']+)'", init_py.read())) setup( name='maxmindupdater', version=metadata['version'], description=metadata['doc'], long_description=readme, author='Yola', author_email='[email protected]', license='MIT (Expat)', url=metadata['doc'], packages=['maxmindupdater'], test_suite='nose.collector', entry_points={ 'console_scripts': ['maxmind-updater=maxmindupdater.__main__:main'], }, install_requires=[ 'requests >= 2.0.0, < 3.0.0', 'maxminddb >= 1.0.0, < 2.0.0' ], classifiers=[ 'License :: OSI Approved :: MIT License', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', ], ) <commit_msg>Include more general python classifiers for searchability<commit_after>#!/usr/bin/env python import re from codecs import open from setuptools import setup with open('README.rst', encoding='utf8') as readme_file: readme = readme_file.read() with open('maxmindupdater/__init__.py', encoding='utf8') as init_py: metadata = dict(re.findall(r"__([a-z]+)__ = '([^']+)'", init_py.read())) setup( name='maxmindupdater', version=metadata['version'], description=metadata['doc'], long_description=readme, author='Yola', author_email='[email protected]', license='MIT (Expat)', url=metadata['doc'], packages=['maxmindupdater'], test_suite='nose.collector', entry_points={ 'console_scripts': ['maxmind-updater=maxmindupdater.__main__:main'], }, install_requires=[ 'requests >= 2.0.0, < 3.0.0', 'maxminddb >= 1.0.0, < 2.0.0' ], classifiers=[ 'License :: OSI Approved :: MIT License', 'Programming Language :: Python', 'Programming Language :: Python :: 2', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', ], )
5ed918c6ff33ef2cda2f5548d2f27f9fcf7deaf7
setup.py
setup.py
# This Source Code Form is subject to the terms of the Mozilla Public # License, v. 2.0. If a copy of the MPL was not distributed with this file, # You can obtain one at http://mozilla.org/MPL/2.0/. from setuptools import setup PACKAGE_VERSION = '0.1' deps = ['fxos-appgen>=0.2.7', 'marionette_client>=0.7.1.1', 'marionette_extension >= 0.1', 'mozdevice >= 0.33', 'mozlog >= 1.6', 'moznetwork >= 0.24', 'mozprocess >= 0.18', 'wptserve >= 1.0.1', 'wptrunner >= 0.2.6'] setup(name='fxos-certsuite', version=PACKAGE_VERSION, description='Certification suite for FirefoxOS', classifiers=[], keywords='mozilla', author='Mozilla Automation and Testing Team', author_email='[email protected]', url='https://github.com/mozilla-b2g/fxos-certsuite', license='MPL', packages=['certsuite'], include_package_data=True, zip_safe=False, install_requires=deps, entry_points=""" # -*- Entry points: -*- [console_scripts] runcertsuite = certsuite:harness_main cert = certsuite:certcli """)
# This Source Code Form is subject to the terms of the Mozilla Public # License, v. 2.0. If a copy of the MPL was not distributed with this file, # You can obtain one at http://mozilla.org/MPL/2.0/. from setuptools import setup PACKAGE_VERSION = '0.1' deps = ['fxos-appgen>=0.2.7', 'marionette_client>=0.7.1.1', 'marionette_extension >= 0.1', 'mozdevice >= 0.33', 'mozlog >= 1.6', 'moznetwork >= 0.24', 'mozprocess >= 0.18', 'wptserve >= 1.0.1', 'wptrunner >= 0.2.7, < 0.3'] setup(name='fxos-certsuite', version=PACKAGE_VERSION, description='Certification suite for FirefoxOS', classifiers=[], keywords='mozilla', author='Mozilla Automation and Testing Team', author_email='[email protected]', url='https://github.com/mozilla-b2g/fxos-certsuite', license='MPL', packages=['certsuite'], include_package_data=True, zip_safe=False, install_requires=deps, entry_points=""" # -*- Entry points: -*- [console_scripts] runcertsuite = certsuite:harness_main cert = certsuite:certcli """)
Update required version of wptrunner
Update required version of wptrunner
Python
mpl-2.0
oouyang/fxos-certsuite,oouyang/fxos-certsuite,oouyang/fxos-certsuite,cr/fxos-certsuite,Conjuror/fxos-certsuite,oouyang/fxos-certsuite,Conjuror/fxos-certsuite,ShakoHo/fxos-certsuite,askeing/fxos-certsuite,ShakoHo/fxos-certsuite,ypwalter/fxos-certsuite,ypwalter/fxos-certsuite,cr/fxos-certsuite,cr/fxos-certsuite,cr/fxos-certsuite,mozilla-b2g/fxos-certsuite,mozilla-b2g/fxos-certsuite,ypwalter/fxos-certsuite,askeing/fxos-certsuite,ShakoHo/fxos-certsuite,Conjuror/fxos-certsuite,oouyang/fxos-certsuite,ypwalter/fxos-certsuite,oouyang/fxos-certsuite,cr/fxos-certsuite,mozilla-b2g/fxos-certsuite,askeing/fxos-certsuite,oouyang/fxos-certsuite,Conjuror/fxos-certsuite,cr/fxos-certsuite,mozilla-b2g/fxos-certsuite,ShakoHo/fxos-certsuite,ypwalter/fxos-certsuite,cr/fxos-certsuite,ypwalter/fxos-certsuite,Conjuror/fxos-certsuite,askeing/fxos-certsuite,Conjuror/fxos-certsuite,mozilla-b2g/fxos-certsuite,ShakoHo/fxos-certsuite,Conjuror/fxos-certsuite,ypwalter/fxos-certsuite,askeing/fxos-certsuite,ShakoHo/fxos-certsuite,askeing/fxos-certsuite,askeing/fxos-certsuite,mozilla-b2g/fxos-certsuite,mozilla-b2g/fxos-certsuite,ShakoHo/fxos-certsuite
# This Source Code Form is subject to the terms of the Mozilla Public # License, v. 2.0. If a copy of the MPL was not distributed with this file, # You can obtain one at http://mozilla.org/MPL/2.0/. from setuptools import setup PACKAGE_VERSION = '0.1' deps = ['fxos-appgen>=0.2.7', 'marionette_client>=0.7.1.1', 'marionette_extension >= 0.1', 'mozdevice >= 0.33', 'mozlog >= 1.6', 'moznetwork >= 0.24', 'mozprocess >= 0.18', 'wptserve >= 1.0.1', 'wptrunner >= 0.2.6'] setup(name='fxos-certsuite', version=PACKAGE_VERSION, description='Certification suite for FirefoxOS', classifiers=[], keywords='mozilla', author='Mozilla Automation and Testing Team', author_email='[email protected]', url='https://github.com/mozilla-b2g/fxos-certsuite', license='MPL', packages=['certsuite'], include_package_data=True, zip_safe=False, install_requires=deps, entry_points=""" # -*- Entry points: -*- [console_scripts] runcertsuite = certsuite:harness_main cert = certsuite:certcli """) Update required version of wptrunner
# This Source Code Form is subject to the terms of the Mozilla Public # License, v. 2.0. If a copy of the MPL was not distributed with this file, # You can obtain one at http://mozilla.org/MPL/2.0/. from setuptools import setup PACKAGE_VERSION = '0.1' deps = ['fxos-appgen>=0.2.7', 'marionette_client>=0.7.1.1', 'marionette_extension >= 0.1', 'mozdevice >= 0.33', 'mozlog >= 1.6', 'moznetwork >= 0.24', 'mozprocess >= 0.18', 'wptserve >= 1.0.1', 'wptrunner >= 0.2.7, < 0.3'] setup(name='fxos-certsuite', version=PACKAGE_VERSION, description='Certification suite for FirefoxOS', classifiers=[], keywords='mozilla', author='Mozilla Automation and Testing Team', author_email='[email protected]', url='https://github.com/mozilla-b2g/fxos-certsuite', license='MPL', packages=['certsuite'], include_package_data=True, zip_safe=False, install_requires=deps, entry_points=""" # -*- Entry points: -*- [console_scripts] runcertsuite = certsuite:harness_main cert = certsuite:certcli """)
<commit_before># This Source Code Form is subject to the terms of the Mozilla Public # License, v. 2.0. If a copy of the MPL was not distributed with this file, # You can obtain one at http://mozilla.org/MPL/2.0/. from setuptools import setup PACKAGE_VERSION = '0.1' deps = ['fxos-appgen>=0.2.7', 'marionette_client>=0.7.1.1', 'marionette_extension >= 0.1', 'mozdevice >= 0.33', 'mozlog >= 1.6', 'moznetwork >= 0.24', 'mozprocess >= 0.18', 'wptserve >= 1.0.1', 'wptrunner >= 0.2.6'] setup(name='fxos-certsuite', version=PACKAGE_VERSION, description='Certification suite for FirefoxOS', classifiers=[], keywords='mozilla', author='Mozilla Automation and Testing Team', author_email='[email protected]', url='https://github.com/mozilla-b2g/fxos-certsuite', license='MPL', packages=['certsuite'], include_package_data=True, zip_safe=False, install_requires=deps, entry_points=""" # -*- Entry points: -*- [console_scripts] runcertsuite = certsuite:harness_main cert = certsuite:certcli """) <commit_msg>Update required version of wptrunner<commit_after>
# This Source Code Form is subject to the terms of the Mozilla Public # License, v. 2.0. If a copy of the MPL was not distributed with this file, # You can obtain one at http://mozilla.org/MPL/2.0/. from setuptools import setup PACKAGE_VERSION = '0.1' deps = ['fxos-appgen>=0.2.7', 'marionette_client>=0.7.1.1', 'marionette_extension >= 0.1', 'mozdevice >= 0.33', 'mozlog >= 1.6', 'moznetwork >= 0.24', 'mozprocess >= 0.18', 'wptserve >= 1.0.1', 'wptrunner >= 0.2.7, < 0.3'] setup(name='fxos-certsuite', version=PACKAGE_VERSION, description='Certification suite for FirefoxOS', classifiers=[], keywords='mozilla', author='Mozilla Automation and Testing Team', author_email='[email protected]', url='https://github.com/mozilla-b2g/fxos-certsuite', license='MPL', packages=['certsuite'], include_package_data=True, zip_safe=False, install_requires=deps, entry_points=""" # -*- Entry points: -*- [console_scripts] runcertsuite = certsuite:harness_main cert = certsuite:certcli """)
# This Source Code Form is subject to the terms of the Mozilla Public # License, v. 2.0. If a copy of the MPL was not distributed with this file, # You can obtain one at http://mozilla.org/MPL/2.0/. from setuptools import setup PACKAGE_VERSION = '0.1' deps = ['fxos-appgen>=0.2.7', 'marionette_client>=0.7.1.1', 'marionette_extension >= 0.1', 'mozdevice >= 0.33', 'mozlog >= 1.6', 'moznetwork >= 0.24', 'mozprocess >= 0.18', 'wptserve >= 1.0.1', 'wptrunner >= 0.2.6'] setup(name='fxos-certsuite', version=PACKAGE_VERSION, description='Certification suite for FirefoxOS', classifiers=[], keywords='mozilla', author='Mozilla Automation and Testing Team', author_email='[email protected]', url='https://github.com/mozilla-b2g/fxos-certsuite', license='MPL', packages=['certsuite'], include_package_data=True, zip_safe=False, install_requires=deps, entry_points=""" # -*- Entry points: -*- [console_scripts] runcertsuite = certsuite:harness_main cert = certsuite:certcli """) Update required version of wptrunner# This Source Code Form is subject to the terms of the Mozilla Public # License, v. 2.0. If a copy of the MPL was not distributed with this file, # You can obtain one at http://mozilla.org/MPL/2.0/. from setuptools import setup PACKAGE_VERSION = '0.1' deps = ['fxos-appgen>=0.2.7', 'marionette_client>=0.7.1.1', 'marionette_extension >= 0.1', 'mozdevice >= 0.33', 'mozlog >= 1.6', 'moznetwork >= 0.24', 'mozprocess >= 0.18', 'wptserve >= 1.0.1', 'wptrunner >= 0.2.7, < 0.3'] setup(name='fxos-certsuite', version=PACKAGE_VERSION, description='Certification suite for FirefoxOS', classifiers=[], keywords='mozilla', author='Mozilla Automation and Testing Team', author_email='[email protected]', url='https://github.com/mozilla-b2g/fxos-certsuite', license='MPL', packages=['certsuite'], include_package_data=True, zip_safe=False, install_requires=deps, entry_points=""" # -*- Entry points: -*- [console_scripts] runcertsuite = certsuite:harness_main cert = certsuite:certcli """)
<commit_before># This Source Code Form is subject to the terms of the Mozilla Public # License, v. 2.0. If a copy of the MPL was not distributed with this file, # You can obtain one at http://mozilla.org/MPL/2.0/. from setuptools import setup PACKAGE_VERSION = '0.1' deps = ['fxos-appgen>=0.2.7', 'marionette_client>=0.7.1.1', 'marionette_extension >= 0.1', 'mozdevice >= 0.33', 'mozlog >= 1.6', 'moznetwork >= 0.24', 'mozprocess >= 0.18', 'wptserve >= 1.0.1', 'wptrunner >= 0.2.6'] setup(name='fxos-certsuite', version=PACKAGE_VERSION, description='Certification suite for FirefoxOS', classifiers=[], keywords='mozilla', author='Mozilla Automation and Testing Team', author_email='[email protected]', url='https://github.com/mozilla-b2g/fxos-certsuite', license='MPL', packages=['certsuite'], include_package_data=True, zip_safe=False, install_requires=deps, entry_points=""" # -*- Entry points: -*- [console_scripts] runcertsuite = certsuite:harness_main cert = certsuite:certcli """) <commit_msg>Update required version of wptrunner<commit_after># This Source Code Form is subject to the terms of the Mozilla Public # License, v. 2.0. If a copy of the MPL was not distributed with this file, # You can obtain one at http://mozilla.org/MPL/2.0/. from setuptools import setup PACKAGE_VERSION = '0.1' deps = ['fxos-appgen>=0.2.7', 'marionette_client>=0.7.1.1', 'marionette_extension >= 0.1', 'mozdevice >= 0.33', 'mozlog >= 1.6', 'moznetwork >= 0.24', 'mozprocess >= 0.18', 'wptserve >= 1.0.1', 'wptrunner >= 0.2.7, < 0.3'] setup(name='fxos-certsuite', version=PACKAGE_VERSION, description='Certification suite for FirefoxOS', classifiers=[], keywords='mozilla', author='Mozilla Automation and Testing Team', author_email='[email protected]', url='https://github.com/mozilla-b2g/fxos-certsuite', license='MPL', packages=['certsuite'], include_package_data=True, zip_safe=False, install_requires=deps, entry_points=""" # -*- Entry points: -*- [console_scripts] runcertsuite = certsuite:harness_main cert = certsuite:certcli """)
d379bc510cac88434e9eb26a630e819870608b04
setup.py
setup.py
from setuptools import setup, find_packages setup( name='matmeta', version='0.1.0', url='https://github.com/jasonthiese/CommonMetadata', description='Common support for meta-data', author='Jason Thiese', author_email="[email protected]", license="Apache v2", packages=find_packages(), install_requires=[ 'pypif' ] )
from setuptools import setup, find_packages setup( name='matmeta', version='0.1.0', url='https://github.com/MaterialsDataInfrastructureConsortium/CommonMetadata', description='Common support for materials metadata', author='Jason Thiese', author_email="[email protected]", license="Apache v2", packages=find_packages(), install_requires=[ 'pypif' ] )
Update the URL while we're at it
Update the URL while we're at it
Python
apache-2.0
MaterialsDataInfrastructureConsortium/CommonMetadata
from setuptools import setup, find_packages setup( name='matmeta', version='0.1.0', url='https://github.com/jasonthiese/CommonMetadata', description='Common support for meta-data', author='Jason Thiese', author_email="[email protected]", license="Apache v2", packages=find_packages(), install_requires=[ 'pypif' ] ) Update the URL while we're at it
from setuptools import setup, find_packages setup( name='matmeta', version='0.1.0', url='https://github.com/MaterialsDataInfrastructureConsortium/CommonMetadata', description='Common support for materials metadata', author='Jason Thiese', author_email="[email protected]", license="Apache v2", packages=find_packages(), install_requires=[ 'pypif' ] )
<commit_before>from setuptools import setup, find_packages setup( name='matmeta', version='0.1.0', url='https://github.com/jasonthiese/CommonMetadata', description='Common support for meta-data', author='Jason Thiese', author_email="[email protected]", license="Apache v2", packages=find_packages(), install_requires=[ 'pypif' ] ) <commit_msg>Update the URL while we're at it<commit_after>
from setuptools import setup, find_packages setup( name='matmeta', version='0.1.0', url='https://github.com/MaterialsDataInfrastructureConsortium/CommonMetadata', description='Common support for materials metadata', author='Jason Thiese', author_email="[email protected]", license="Apache v2", packages=find_packages(), install_requires=[ 'pypif' ] )
from setuptools import setup, find_packages setup( name='matmeta', version='0.1.0', url='https://github.com/jasonthiese/CommonMetadata', description='Common support for meta-data', author='Jason Thiese', author_email="[email protected]", license="Apache v2", packages=find_packages(), install_requires=[ 'pypif' ] ) Update the URL while we're at itfrom setuptools import setup, find_packages setup( name='matmeta', version='0.1.0', url='https://github.com/MaterialsDataInfrastructureConsortium/CommonMetadata', description='Common support for materials metadata', author='Jason Thiese', author_email="[email protected]", license="Apache v2", packages=find_packages(), install_requires=[ 'pypif' ] )
<commit_before>from setuptools import setup, find_packages setup( name='matmeta', version='0.1.0', url='https://github.com/jasonthiese/CommonMetadata', description='Common support for meta-data', author='Jason Thiese', author_email="[email protected]", license="Apache v2", packages=find_packages(), install_requires=[ 'pypif' ] ) <commit_msg>Update the URL while we're at it<commit_after>from setuptools import setup, find_packages setup( name='matmeta', version='0.1.0', url='https://github.com/MaterialsDataInfrastructureConsortium/CommonMetadata', description='Common support for materials metadata', author='Jason Thiese', author_email="[email protected]", license="Apache v2", packages=find_packages(), install_requires=[ 'pypif' ] )
63bc45d453759dbe27c8e39bfd521b985dfdaa30
setup.py
setup.py
# -*- coding: utf-8 -*- import pathlib from setuptools import setup def read(file_name): file_path = pathlib.Path(__file__).parent / file_name return file_path.read_text('utf-8') setup( name='cibopath', version='0.1.0', author='Raphael Pierzina', author_email='[email protected]', maintainer='Raphael Pierzina', maintainer_email='[email protected]', license='BSD', url='https://github.com/hackebrot/cibopath', description='Search Cookiecutters on GitHub.', long_description=read('README.rst'), packages=[ 'cibopath', ], package_dir={'cibopath': 'cibopath'}, include_package_data=True, zip_safe=False, install_requires=[ 'click', 'aiohttp', ], entry_points={ 'console_scripts': [ 'cibopath = cibopath.cli:main', ] }, classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Natural Language :: English', 'Operating System :: OS Independent', 'Programming Language :: Python :: 3 :: Only', 'Programming Language :: Python :: 3.5', 'Programming Language :: Python :: Implementation :: CPython', ], keywords=['Cookiecutter', 'Web Scraping', 'Asyncio'], )
# -*- coding: utf-8 -*- import pathlib from setuptools import setup def read(file_name): file_path = pathlib.Path(__file__).parent / file_name return file_path.read_text('utf-8') setup( name='cibopath', version='0.1.0', author='Raphael Pierzina', author_email='[email protected]', maintainer='Raphael Pierzina', maintainer_email='[email protected]', license='BSD', url='https://github.com/hackebrot/cibopath', description='Search Cookiecutters on GitHub.', long_description=read('README.rst'), packages=[ 'cibopath', ], package_dir={'cibopath': 'cibopath'}, include_package_data=True, zip_safe=False, install_requires=[ 'click', 'aiohttp', ], entry_points={ 'console_scripts': [ 'cibopath = cibopath.cli:main', ] }, classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Natural Language :: English', 'Operating System :: OS Independent', 'Programming Language :: Python :: 3 :: Only', 'Programming Language :: Python :: 3.5', 'Programming Language :: Python :: Implementation :: CPython', ], keywords=['cookiecutter', 'web scraping', 'asyncio', 'command-line'], )
Use all lower pypi keywords and add command-line
Use all lower pypi keywords and add command-line
Python
bsd-3-clause
hackebrot/cibopath
# -*- coding: utf-8 -*- import pathlib from setuptools import setup def read(file_name): file_path = pathlib.Path(__file__).parent / file_name return file_path.read_text('utf-8') setup( name='cibopath', version='0.1.0', author='Raphael Pierzina', author_email='[email protected]', maintainer='Raphael Pierzina', maintainer_email='[email protected]', license='BSD', url='https://github.com/hackebrot/cibopath', description='Search Cookiecutters on GitHub.', long_description=read('README.rst'), packages=[ 'cibopath', ], package_dir={'cibopath': 'cibopath'}, include_package_data=True, zip_safe=False, install_requires=[ 'click', 'aiohttp', ], entry_points={ 'console_scripts': [ 'cibopath = cibopath.cli:main', ] }, classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Natural Language :: English', 'Operating System :: OS Independent', 'Programming Language :: Python :: 3 :: Only', 'Programming Language :: Python :: 3.5', 'Programming Language :: Python :: Implementation :: CPython', ], keywords=['Cookiecutter', 'Web Scraping', 'Asyncio'], ) Use all lower pypi keywords and add command-line
# -*- coding: utf-8 -*- import pathlib from setuptools import setup def read(file_name): file_path = pathlib.Path(__file__).parent / file_name return file_path.read_text('utf-8') setup( name='cibopath', version='0.1.0', author='Raphael Pierzina', author_email='[email protected]', maintainer='Raphael Pierzina', maintainer_email='[email protected]', license='BSD', url='https://github.com/hackebrot/cibopath', description='Search Cookiecutters on GitHub.', long_description=read('README.rst'), packages=[ 'cibopath', ], package_dir={'cibopath': 'cibopath'}, include_package_data=True, zip_safe=False, install_requires=[ 'click', 'aiohttp', ], entry_points={ 'console_scripts': [ 'cibopath = cibopath.cli:main', ] }, classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Natural Language :: English', 'Operating System :: OS Independent', 'Programming Language :: Python :: 3 :: Only', 'Programming Language :: Python :: 3.5', 'Programming Language :: Python :: Implementation :: CPython', ], keywords=['cookiecutter', 'web scraping', 'asyncio', 'command-line'], )
<commit_before># -*- coding: utf-8 -*- import pathlib from setuptools import setup def read(file_name): file_path = pathlib.Path(__file__).parent / file_name return file_path.read_text('utf-8') setup( name='cibopath', version='0.1.0', author='Raphael Pierzina', author_email='[email protected]', maintainer='Raphael Pierzina', maintainer_email='[email protected]', license='BSD', url='https://github.com/hackebrot/cibopath', description='Search Cookiecutters on GitHub.', long_description=read('README.rst'), packages=[ 'cibopath', ], package_dir={'cibopath': 'cibopath'}, include_package_data=True, zip_safe=False, install_requires=[ 'click', 'aiohttp', ], entry_points={ 'console_scripts': [ 'cibopath = cibopath.cli:main', ] }, classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Natural Language :: English', 'Operating System :: OS Independent', 'Programming Language :: Python :: 3 :: Only', 'Programming Language :: Python :: 3.5', 'Programming Language :: Python :: Implementation :: CPython', ], keywords=['Cookiecutter', 'Web Scraping', 'Asyncio'], ) <commit_msg>Use all lower pypi keywords and add command-line<commit_after>
# -*- coding: utf-8 -*- import pathlib from setuptools import setup def read(file_name): file_path = pathlib.Path(__file__).parent / file_name return file_path.read_text('utf-8') setup( name='cibopath', version='0.1.0', author='Raphael Pierzina', author_email='[email protected]', maintainer='Raphael Pierzina', maintainer_email='[email protected]', license='BSD', url='https://github.com/hackebrot/cibopath', description='Search Cookiecutters on GitHub.', long_description=read('README.rst'), packages=[ 'cibopath', ], package_dir={'cibopath': 'cibopath'}, include_package_data=True, zip_safe=False, install_requires=[ 'click', 'aiohttp', ], entry_points={ 'console_scripts': [ 'cibopath = cibopath.cli:main', ] }, classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Natural Language :: English', 'Operating System :: OS Independent', 'Programming Language :: Python :: 3 :: Only', 'Programming Language :: Python :: 3.5', 'Programming Language :: Python :: Implementation :: CPython', ], keywords=['cookiecutter', 'web scraping', 'asyncio', 'command-line'], )
# -*- coding: utf-8 -*- import pathlib from setuptools import setup def read(file_name): file_path = pathlib.Path(__file__).parent / file_name return file_path.read_text('utf-8') setup( name='cibopath', version='0.1.0', author='Raphael Pierzina', author_email='[email protected]', maintainer='Raphael Pierzina', maintainer_email='[email protected]', license='BSD', url='https://github.com/hackebrot/cibopath', description='Search Cookiecutters on GitHub.', long_description=read('README.rst'), packages=[ 'cibopath', ], package_dir={'cibopath': 'cibopath'}, include_package_data=True, zip_safe=False, install_requires=[ 'click', 'aiohttp', ], entry_points={ 'console_scripts': [ 'cibopath = cibopath.cli:main', ] }, classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Natural Language :: English', 'Operating System :: OS Independent', 'Programming Language :: Python :: 3 :: Only', 'Programming Language :: Python :: 3.5', 'Programming Language :: Python :: Implementation :: CPython', ], keywords=['Cookiecutter', 'Web Scraping', 'Asyncio'], ) Use all lower pypi keywords and add command-line# -*- coding: utf-8 -*- import pathlib from setuptools import setup def read(file_name): file_path = pathlib.Path(__file__).parent / file_name return file_path.read_text('utf-8') setup( name='cibopath', version='0.1.0', author='Raphael Pierzina', author_email='[email protected]', maintainer='Raphael Pierzina', maintainer_email='[email protected]', license='BSD', url='https://github.com/hackebrot/cibopath', description='Search Cookiecutters on GitHub.', long_description=read('README.rst'), packages=[ 'cibopath', ], package_dir={'cibopath': 'cibopath'}, include_package_data=True, zip_safe=False, install_requires=[ 'click', 'aiohttp', ], entry_points={ 'console_scripts': [ 'cibopath = cibopath.cli:main', ] }, classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Natural Language :: English', 'Operating System :: OS Independent', 'Programming Language :: Python :: 3 :: Only', 'Programming Language :: Python :: 3.5', 'Programming Language :: Python :: Implementation :: CPython', ], keywords=['cookiecutter', 'web scraping', 'asyncio', 'command-line'], )
<commit_before># -*- coding: utf-8 -*- import pathlib from setuptools import setup def read(file_name): file_path = pathlib.Path(__file__).parent / file_name return file_path.read_text('utf-8') setup( name='cibopath', version='0.1.0', author='Raphael Pierzina', author_email='[email protected]', maintainer='Raphael Pierzina', maintainer_email='[email protected]', license='BSD', url='https://github.com/hackebrot/cibopath', description='Search Cookiecutters on GitHub.', long_description=read('README.rst'), packages=[ 'cibopath', ], package_dir={'cibopath': 'cibopath'}, include_package_data=True, zip_safe=False, install_requires=[ 'click', 'aiohttp', ], entry_points={ 'console_scripts': [ 'cibopath = cibopath.cli:main', ] }, classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Natural Language :: English', 'Operating System :: OS Independent', 'Programming Language :: Python :: 3 :: Only', 'Programming Language :: Python :: 3.5', 'Programming Language :: Python :: Implementation :: CPython', ], keywords=['Cookiecutter', 'Web Scraping', 'Asyncio'], ) <commit_msg>Use all lower pypi keywords and add command-line<commit_after># -*- coding: utf-8 -*- import pathlib from setuptools import setup def read(file_name): file_path = pathlib.Path(__file__).parent / file_name return file_path.read_text('utf-8') setup( name='cibopath', version='0.1.0', author='Raphael Pierzina', author_email='[email protected]', maintainer='Raphael Pierzina', maintainer_email='[email protected]', license='BSD', url='https://github.com/hackebrot/cibopath', description='Search Cookiecutters on GitHub.', long_description=read('README.rst'), packages=[ 'cibopath', ], package_dir={'cibopath': 'cibopath'}, include_package_data=True, zip_safe=False, install_requires=[ 'click', 'aiohttp', ], entry_points={ 'console_scripts': [ 'cibopath = cibopath.cli:main', ] }, classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Natural Language :: English', 'Operating System :: OS Independent', 'Programming Language :: Python :: 3 :: Only', 'Programming Language :: Python :: 3.5', 'Programming Language :: Python :: Implementation :: CPython', ], keywords=['cookiecutter', 'web scraping', 'asyncio', 'command-line'], )
d34d8ff6ca7fa5c3a0171c6255292e1fac8647c8
setup.py
setup.py
#!/usr/bin/env python import os import skosprovider_oe try: from setuptools import setup except ImportError: from distutils.core import setup packages = [ 'skosprovider_oe', ] requires = [ 'skosprovider', 'requests>0.14,<0.14.99' ] setup( name='skosprovider_oe', version='0.1.0', description='A SKOS provider for OE vocabularies.', long_description=open('README.rst').read() + '\n\n' + open('HISTORY.rst').read(), author='Koen Van Daele', author_email='[email protected]', url='http://github.com/koenedaele/skosprovider_oe', packages=packages, package_data={'': ['LICENSE']}, package_dir={'skosprovider': 'skosprovider'}, include_package_data=True, install_requires=requires, license=open('LICENSE').read(), zip_safe=False, classifiers=( 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'Natural Language :: English', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python', 'Programming Language :: Python :: 2.7', ), )
#!/usr/bin/env python import os import skosprovider_oe try: from setuptools import setup except ImportError: from distutils.core import setup packages = [ 'skosprovider_oe', ] requires = [ 'skosprovider', 'requests>=1.0.0' ] setup( name='skosprovider_oe', version='0.1.0', description='A SKOS provider for OE vocabularies.', long_description=open('README.rst').read() + '\n\n' + open('HISTORY.rst').read(), author='Koen Van Daele', author_email='[email protected]', url='http://github.com/koenedaele/skosprovider_oe', packages=packages, package_data={'': ['LICENSE']}, package_dir={'skosprovider': 'skosprovider'}, include_package_data=True, install_requires=requires, license=open('LICENSE').read(), zip_safe=False, classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'Natural Language :: English', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python', 'Programming Language :: Python :: 2.7', ], )
Upgrade requests to versions > 1.0.0
Upgrade requests to versions > 1.0.0
Python
mit
koenedaele/skosprovider_oe
#!/usr/bin/env python import os import skosprovider_oe try: from setuptools import setup except ImportError: from distutils.core import setup packages = [ 'skosprovider_oe', ] requires = [ 'skosprovider', 'requests>0.14,<0.14.99' ] setup( name='skosprovider_oe', version='0.1.0', description='A SKOS provider for OE vocabularies.', long_description=open('README.rst').read() + '\n\n' + open('HISTORY.rst').read(), author='Koen Van Daele', author_email='[email protected]', url='http://github.com/koenedaele/skosprovider_oe', packages=packages, package_data={'': ['LICENSE']}, package_dir={'skosprovider': 'skosprovider'}, include_package_data=True, install_requires=requires, license=open('LICENSE').read(), zip_safe=False, classifiers=( 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'Natural Language :: English', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python', 'Programming Language :: Python :: 2.7', ), ) Upgrade requests to versions > 1.0.0
#!/usr/bin/env python import os import skosprovider_oe try: from setuptools import setup except ImportError: from distutils.core import setup packages = [ 'skosprovider_oe', ] requires = [ 'skosprovider', 'requests>=1.0.0' ] setup( name='skosprovider_oe', version='0.1.0', description='A SKOS provider for OE vocabularies.', long_description=open('README.rst').read() + '\n\n' + open('HISTORY.rst').read(), author='Koen Van Daele', author_email='[email protected]', url='http://github.com/koenedaele/skosprovider_oe', packages=packages, package_data={'': ['LICENSE']}, package_dir={'skosprovider': 'skosprovider'}, include_package_data=True, install_requires=requires, license=open('LICENSE').read(), zip_safe=False, classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'Natural Language :: English', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python', 'Programming Language :: Python :: 2.7', ], )
<commit_before>#!/usr/bin/env python import os import skosprovider_oe try: from setuptools import setup except ImportError: from distutils.core import setup packages = [ 'skosprovider_oe', ] requires = [ 'skosprovider', 'requests>0.14,<0.14.99' ] setup( name='skosprovider_oe', version='0.1.0', description='A SKOS provider for OE vocabularies.', long_description=open('README.rst').read() + '\n\n' + open('HISTORY.rst').read(), author='Koen Van Daele', author_email='[email protected]', url='http://github.com/koenedaele/skosprovider_oe', packages=packages, package_data={'': ['LICENSE']}, package_dir={'skosprovider': 'skosprovider'}, include_package_data=True, install_requires=requires, license=open('LICENSE').read(), zip_safe=False, classifiers=( 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'Natural Language :: English', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python', 'Programming Language :: Python :: 2.7', ), ) <commit_msg>Upgrade requests to versions > 1.0.0<commit_after>
#!/usr/bin/env python import os import skosprovider_oe try: from setuptools import setup except ImportError: from distutils.core import setup packages = [ 'skosprovider_oe', ] requires = [ 'skosprovider', 'requests>=1.0.0' ] setup( name='skosprovider_oe', version='0.1.0', description='A SKOS provider for OE vocabularies.', long_description=open('README.rst').read() + '\n\n' + open('HISTORY.rst').read(), author='Koen Van Daele', author_email='[email protected]', url='http://github.com/koenedaele/skosprovider_oe', packages=packages, package_data={'': ['LICENSE']}, package_dir={'skosprovider': 'skosprovider'}, include_package_data=True, install_requires=requires, license=open('LICENSE').read(), zip_safe=False, classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'Natural Language :: English', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python', 'Programming Language :: Python :: 2.7', ], )
#!/usr/bin/env python import os import skosprovider_oe try: from setuptools import setup except ImportError: from distutils.core import setup packages = [ 'skosprovider_oe', ] requires = [ 'skosprovider', 'requests>0.14,<0.14.99' ] setup( name='skosprovider_oe', version='0.1.0', description='A SKOS provider for OE vocabularies.', long_description=open('README.rst').read() + '\n\n' + open('HISTORY.rst').read(), author='Koen Van Daele', author_email='[email protected]', url='http://github.com/koenedaele/skosprovider_oe', packages=packages, package_data={'': ['LICENSE']}, package_dir={'skosprovider': 'skosprovider'}, include_package_data=True, install_requires=requires, license=open('LICENSE').read(), zip_safe=False, classifiers=( 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'Natural Language :: English', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python', 'Programming Language :: Python :: 2.7', ), ) Upgrade requests to versions > 1.0.0#!/usr/bin/env python import os import skosprovider_oe try: from setuptools import setup except ImportError: from distutils.core import setup packages = [ 'skosprovider_oe', ] requires = [ 'skosprovider', 'requests>=1.0.0' ] setup( name='skosprovider_oe', version='0.1.0', description='A SKOS provider for OE vocabularies.', long_description=open('README.rst').read() + '\n\n' + open('HISTORY.rst').read(), author='Koen Van Daele', author_email='[email protected]', url='http://github.com/koenedaele/skosprovider_oe', packages=packages, package_data={'': ['LICENSE']}, package_dir={'skosprovider': 'skosprovider'}, include_package_data=True, install_requires=requires, license=open('LICENSE').read(), zip_safe=False, classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'Natural Language :: English', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python', 'Programming Language :: Python :: 2.7', ], )
<commit_before>#!/usr/bin/env python import os import skosprovider_oe try: from setuptools import setup except ImportError: from distutils.core import setup packages = [ 'skosprovider_oe', ] requires = [ 'skosprovider', 'requests>0.14,<0.14.99' ] setup( name='skosprovider_oe', version='0.1.0', description='A SKOS provider for OE vocabularies.', long_description=open('README.rst').read() + '\n\n' + open('HISTORY.rst').read(), author='Koen Van Daele', author_email='[email protected]', url='http://github.com/koenedaele/skosprovider_oe', packages=packages, package_data={'': ['LICENSE']}, package_dir={'skosprovider': 'skosprovider'}, include_package_data=True, install_requires=requires, license=open('LICENSE').read(), zip_safe=False, classifiers=( 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'Natural Language :: English', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python', 'Programming Language :: Python :: 2.7', ), ) <commit_msg>Upgrade requests to versions > 1.0.0<commit_after>#!/usr/bin/env python import os import skosprovider_oe try: from setuptools import setup except ImportError: from distutils.core import setup packages = [ 'skosprovider_oe', ] requires = [ 'skosprovider', 'requests>=1.0.0' ] setup( name='skosprovider_oe', version='0.1.0', description='A SKOS provider for OE vocabularies.', long_description=open('README.rst').read() + '\n\n' + open('HISTORY.rst').read(), author='Koen Van Daele', author_email='[email protected]', url='http://github.com/koenedaele/skosprovider_oe', packages=packages, package_data={'': ['LICENSE']}, package_dir={'skosprovider': 'skosprovider'}, include_package_data=True, install_requires=requires, license=open('LICENSE').read(), zip_safe=False, classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'Natural Language :: English', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python', 'Programming Language :: Python :: 2.7', ], )
ded771f45dd8e196d53d892b40ac817912902746
setup.py
setup.py
from distutils.core import setup # Keeping all Python code for package in lib directory NAME = 'cplate' VERSION = '0.1' AUTHOR = 'Alexander W Blocker' AUTHOR_EMAIL = '[email protected]' URL = 'http://www.awblocker.com' DESCRIPTION = 'Probablistic deconvolution for chromatin-structure estimation.' REQUIRES = ['numpy(>=1.6)','scipy(>=0.9)', 'yaml', 'mpi4py'] PACKAGE_DIR = {'': 'lib'} PACKAGES = ['cplate'] SCRIPTS = ('deconvolve_em', 'deconvolve_mcmc', 'detect_em', 'summarise_mcmc', 'summarise_clusters_mcmc', 'summarise_params_mcmc') SCRIPTS = ['scripts/cplate_' + script for script in SCRIPTS] setup(name=NAME, url=URL, version=VERSION, description=DESCRIPTION, author=AUTHOR, author_email=AUTHOR_EMAIL, packages=PACKAGES, package_dir=PACKAGE_DIR, scripts=SCRIPTS, requires=REQUIRES )
from distutils.core import setup # Keeping all Python code for package in lib directory NAME = 'cplate' VERSION = '0.1' AUTHOR = 'Alexander W Blocker' AUTHOR_EMAIL = '[email protected]' URL = 'https://www.github.com/awblocker/cplate' DESCRIPTION = 'Probabilistic deconvolution for chromatin-structure estimation.' REQUIRES = ['numpy(>=1.6)','scipy(>=0.9)', 'yaml', 'mpi4py'] PACKAGE_DIR = {'': 'lib'} PACKAGES = ['cplate'] SCRIPTS = ('deconvolve_em', 'deconvolve_mcmc', 'detect_em', 'summarise_mcmc', 'summarise_clusters_mcmc', 'summarise_params_mcmc') SCRIPTS = ['scripts/cplate_' + script for script in SCRIPTS] setup(name=NAME, url=URL, version=VERSION, description=DESCRIPTION, author=AUTHOR, author_email=AUTHOR_EMAIL, packages=PACKAGES, package_dir=PACKAGE_DIR, scripts=SCRIPTS, requires=REQUIRES )
Update URL and fix typo in description.
Update URL and fix typo in description.
Python
apache-2.0
awblocker/cplate,awblocker/cplate
from distutils.core import setup # Keeping all Python code for package in lib directory NAME = 'cplate' VERSION = '0.1' AUTHOR = 'Alexander W Blocker' AUTHOR_EMAIL = '[email protected]' URL = 'http://www.awblocker.com' DESCRIPTION = 'Probablistic deconvolution for chromatin-structure estimation.' REQUIRES = ['numpy(>=1.6)','scipy(>=0.9)', 'yaml', 'mpi4py'] PACKAGE_DIR = {'': 'lib'} PACKAGES = ['cplate'] SCRIPTS = ('deconvolve_em', 'deconvolve_mcmc', 'detect_em', 'summarise_mcmc', 'summarise_clusters_mcmc', 'summarise_params_mcmc') SCRIPTS = ['scripts/cplate_' + script for script in SCRIPTS] setup(name=NAME, url=URL, version=VERSION, description=DESCRIPTION, author=AUTHOR, author_email=AUTHOR_EMAIL, packages=PACKAGES, package_dir=PACKAGE_DIR, scripts=SCRIPTS, requires=REQUIRES ) Update URL and fix typo in description.
from distutils.core import setup # Keeping all Python code for package in lib directory NAME = 'cplate' VERSION = '0.1' AUTHOR = 'Alexander W Blocker' AUTHOR_EMAIL = '[email protected]' URL = 'https://www.github.com/awblocker/cplate' DESCRIPTION = 'Probabilistic deconvolution for chromatin-structure estimation.' REQUIRES = ['numpy(>=1.6)','scipy(>=0.9)', 'yaml', 'mpi4py'] PACKAGE_DIR = {'': 'lib'} PACKAGES = ['cplate'] SCRIPTS = ('deconvolve_em', 'deconvolve_mcmc', 'detect_em', 'summarise_mcmc', 'summarise_clusters_mcmc', 'summarise_params_mcmc') SCRIPTS = ['scripts/cplate_' + script for script in SCRIPTS] setup(name=NAME, url=URL, version=VERSION, description=DESCRIPTION, author=AUTHOR, author_email=AUTHOR_EMAIL, packages=PACKAGES, package_dir=PACKAGE_DIR, scripts=SCRIPTS, requires=REQUIRES )
<commit_before>from distutils.core import setup # Keeping all Python code for package in lib directory NAME = 'cplate' VERSION = '0.1' AUTHOR = 'Alexander W Blocker' AUTHOR_EMAIL = '[email protected]' URL = 'http://www.awblocker.com' DESCRIPTION = 'Probablistic deconvolution for chromatin-structure estimation.' REQUIRES = ['numpy(>=1.6)','scipy(>=0.9)', 'yaml', 'mpi4py'] PACKAGE_DIR = {'': 'lib'} PACKAGES = ['cplate'] SCRIPTS = ('deconvolve_em', 'deconvolve_mcmc', 'detect_em', 'summarise_mcmc', 'summarise_clusters_mcmc', 'summarise_params_mcmc') SCRIPTS = ['scripts/cplate_' + script for script in SCRIPTS] setup(name=NAME, url=URL, version=VERSION, description=DESCRIPTION, author=AUTHOR, author_email=AUTHOR_EMAIL, packages=PACKAGES, package_dir=PACKAGE_DIR, scripts=SCRIPTS, requires=REQUIRES ) <commit_msg>Update URL and fix typo in description.<commit_after>
from distutils.core import setup # Keeping all Python code for package in lib directory NAME = 'cplate' VERSION = '0.1' AUTHOR = 'Alexander W Blocker' AUTHOR_EMAIL = '[email protected]' URL = 'https://www.github.com/awblocker/cplate' DESCRIPTION = 'Probabilistic deconvolution for chromatin-structure estimation.' REQUIRES = ['numpy(>=1.6)','scipy(>=0.9)', 'yaml', 'mpi4py'] PACKAGE_DIR = {'': 'lib'} PACKAGES = ['cplate'] SCRIPTS = ('deconvolve_em', 'deconvolve_mcmc', 'detect_em', 'summarise_mcmc', 'summarise_clusters_mcmc', 'summarise_params_mcmc') SCRIPTS = ['scripts/cplate_' + script for script in SCRIPTS] setup(name=NAME, url=URL, version=VERSION, description=DESCRIPTION, author=AUTHOR, author_email=AUTHOR_EMAIL, packages=PACKAGES, package_dir=PACKAGE_DIR, scripts=SCRIPTS, requires=REQUIRES )
from distutils.core import setup # Keeping all Python code for package in lib directory NAME = 'cplate' VERSION = '0.1' AUTHOR = 'Alexander W Blocker' AUTHOR_EMAIL = '[email protected]' URL = 'http://www.awblocker.com' DESCRIPTION = 'Probablistic deconvolution for chromatin-structure estimation.' REQUIRES = ['numpy(>=1.6)','scipy(>=0.9)', 'yaml', 'mpi4py'] PACKAGE_DIR = {'': 'lib'} PACKAGES = ['cplate'] SCRIPTS = ('deconvolve_em', 'deconvolve_mcmc', 'detect_em', 'summarise_mcmc', 'summarise_clusters_mcmc', 'summarise_params_mcmc') SCRIPTS = ['scripts/cplate_' + script for script in SCRIPTS] setup(name=NAME, url=URL, version=VERSION, description=DESCRIPTION, author=AUTHOR, author_email=AUTHOR_EMAIL, packages=PACKAGES, package_dir=PACKAGE_DIR, scripts=SCRIPTS, requires=REQUIRES ) Update URL and fix typo in description.from distutils.core import setup # Keeping all Python code for package in lib directory NAME = 'cplate' VERSION = '0.1' AUTHOR = 'Alexander W Blocker' AUTHOR_EMAIL = '[email protected]' URL = 'https://www.github.com/awblocker/cplate' DESCRIPTION = 'Probabilistic deconvolution for chromatin-structure estimation.' REQUIRES = ['numpy(>=1.6)','scipy(>=0.9)', 'yaml', 'mpi4py'] PACKAGE_DIR = {'': 'lib'} PACKAGES = ['cplate'] SCRIPTS = ('deconvolve_em', 'deconvolve_mcmc', 'detect_em', 'summarise_mcmc', 'summarise_clusters_mcmc', 'summarise_params_mcmc') SCRIPTS = ['scripts/cplate_' + script for script in SCRIPTS] setup(name=NAME, url=URL, version=VERSION, description=DESCRIPTION, author=AUTHOR, author_email=AUTHOR_EMAIL, packages=PACKAGES, package_dir=PACKAGE_DIR, scripts=SCRIPTS, requires=REQUIRES )
<commit_before>from distutils.core import setup # Keeping all Python code for package in lib directory NAME = 'cplate' VERSION = '0.1' AUTHOR = 'Alexander W Blocker' AUTHOR_EMAIL = '[email protected]' URL = 'http://www.awblocker.com' DESCRIPTION = 'Probablistic deconvolution for chromatin-structure estimation.' REQUIRES = ['numpy(>=1.6)','scipy(>=0.9)', 'yaml', 'mpi4py'] PACKAGE_DIR = {'': 'lib'} PACKAGES = ['cplate'] SCRIPTS = ('deconvolve_em', 'deconvolve_mcmc', 'detect_em', 'summarise_mcmc', 'summarise_clusters_mcmc', 'summarise_params_mcmc') SCRIPTS = ['scripts/cplate_' + script for script in SCRIPTS] setup(name=NAME, url=URL, version=VERSION, description=DESCRIPTION, author=AUTHOR, author_email=AUTHOR_EMAIL, packages=PACKAGES, package_dir=PACKAGE_DIR, scripts=SCRIPTS, requires=REQUIRES ) <commit_msg>Update URL and fix typo in description.<commit_after>from distutils.core import setup # Keeping all Python code for package in lib directory NAME = 'cplate' VERSION = '0.1' AUTHOR = 'Alexander W Blocker' AUTHOR_EMAIL = '[email protected]' URL = 'https://www.github.com/awblocker/cplate' DESCRIPTION = 'Probabilistic deconvolution for chromatin-structure estimation.' REQUIRES = ['numpy(>=1.6)','scipy(>=0.9)', 'yaml', 'mpi4py'] PACKAGE_DIR = {'': 'lib'} PACKAGES = ['cplate'] SCRIPTS = ('deconvolve_em', 'deconvolve_mcmc', 'detect_em', 'summarise_mcmc', 'summarise_clusters_mcmc', 'summarise_params_mcmc') SCRIPTS = ['scripts/cplate_' + script for script in SCRIPTS] setup(name=NAME, url=URL, version=VERSION, description=DESCRIPTION, author=AUTHOR, author_email=AUTHOR_EMAIL, packages=PACKAGES, package_dir=PACKAGE_DIR, scripts=SCRIPTS, requires=REQUIRES )
cc5d2aa34b4426a290e1807c6dee824a1d10fd73
setup.py
setup.py
import os from setuptools import setup, find_packages here = os.path.abspath(os.path.dirname(__file__)) README = open(os.path.join(here, 'README.rst')).read() CHANGES = open(os.path.join(here, 'CHANGES.rst')).read() requires = [ 'pyramid', 'cornice', 'colander', 'couchdb', ] test_requires = requires + ['lettuce', ] setup(name='daybed', version='0.0', description='daybed', long_description=README + '\n\n' + CHANGES, classifiers=[ "Programming Language :: Python", "Framework :: Pylons", "Topic :: Internet :: WWW/HTTP", "Topic :: Internet :: WWW/HTTP :: WSGI :: Application", ], author='', author_email='', url='', keywords='web pyramid pylons', packages=find_packages(), include_package_data=True, zip_safe=False, install_requires=requires, tests_require=test_requires, test_suite="daybed.tests", entry_points="""\ [paste.app_factory] main = daybed:main """, )
import os from setuptools import setup, find_packages here = os.path.abspath(os.path.dirname(__file__)) README = open(os.path.join(here, 'README.rst')).read() CHANGES = open(os.path.join(here, 'CHANGES.rst')).read() requires = [ 'pyramid', 'cornice', 'colander', 'couchdb', ] test_requires = requires + ['lettuce', ] setup(name='daybed', version='0.0', description='daybed', long_description=README + '\n\n' + CHANGES, classifiers=[ "Programming Language :: Python", "Framework :: Pylons", "Topic :: Internet :: WWW/HTTP", "Topic :: Internet :: WWW/HTTP :: WSGI :: Application", ], author='', author_email='', url='', keywords='web pyramid pylons', packages=find_packages(), dependency_links = [ "https://github.com/mozilla-services/cornice/tarball/spore-support#egg=cornice" ], include_package_data=True, zip_safe=False, install_requires=requires, tests_require=test_requires, test_suite="daybed.tests", entry_points="""\ [paste.app_factory] main = daybed:main """, )
Install the spore branch of cornice
Install the spore branch of cornice
Python
bsd-3-clause
spiral-project/daybed,spiral-project/daybed
import os from setuptools import setup, find_packages here = os.path.abspath(os.path.dirname(__file__)) README = open(os.path.join(here, 'README.rst')).read() CHANGES = open(os.path.join(here, 'CHANGES.rst')).read() requires = [ 'pyramid', 'cornice', 'colander', 'couchdb', ] test_requires = requires + ['lettuce', ] setup(name='daybed', version='0.0', description='daybed', long_description=README + '\n\n' + CHANGES, classifiers=[ "Programming Language :: Python", "Framework :: Pylons", "Topic :: Internet :: WWW/HTTP", "Topic :: Internet :: WWW/HTTP :: WSGI :: Application", ], author='', author_email='', url='', keywords='web pyramid pylons', packages=find_packages(), include_package_data=True, zip_safe=False, install_requires=requires, tests_require=test_requires, test_suite="daybed.tests", entry_points="""\ [paste.app_factory] main = daybed:main """, ) Install the spore branch of cornice
import os from setuptools import setup, find_packages here = os.path.abspath(os.path.dirname(__file__)) README = open(os.path.join(here, 'README.rst')).read() CHANGES = open(os.path.join(here, 'CHANGES.rst')).read() requires = [ 'pyramid', 'cornice', 'colander', 'couchdb', ] test_requires = requires + ['lettuce', ] setup(name='daybed', version='0.0', description='daybed', long_description=README + '\n\n' + CHANGES, classifiers=[ "Programming Language :: Python", "Framework :: Pylons", "Topic :: Internet :: WWW/HTTP", "Topic :: Internet :: WWW/HTTP :: WSGI :: Application", ], author='', author_email='', url='', keywords='web pyramid pylons', packages=find_packages(), dependency_links = [ "https://github.com/mozilla-services/cornice/tarball/spore-support#egg=cornice" ], include_package_data=True, zip_safe=False, install_requires=requires, tests_require=test_requires, test_suite="daybed.tests", entry_points="""\ [paste.app_factory] main = daybed:main """, )
<commit_before>import os from setuptools import setup, find_packages here = os.path.abspath(os.path.dirname(__file__)) README = open(os.path.join(here, 'README.rst')).read() CHANGES = open(os.path.join(here, 'CHANGES.rst')).read() requires = [ 'pyramid', 'cornice', 'colander', 'couchdb', ] test_requires = requires + ['lettuce', ] setup(name='daybed', version='0.0', description='daybed', long_description=README + '\n\n' + CHANGES, classifiers=[ "Programming Language :: Python", "Framework :: Pylons", "Topic :: Internet :: WWW/HTTP", "Topic :: Internet :: WWW/HTTP :: WSGI :: Application", ], author='', author_email='', url='', keywords='web pyramid pylons', packages=find_packages(), include_package_data=True, zip_safe=False, install_requires=requires, tests_require=test_requires, test_suite="daybed.tests", entry_points="""\ [paste.app_factory] main = daybed:main """, ) <commit_msg>Install the spore branch of cornice<commit_after>
import os from setuptools import setup, find_packages here = os.path.abspath(os.path.dirname(__file__)) README = open(os.path.join(here, 'README.rst')).read() CHANGES = open(os.path.join(here, 'CHANGES.rst')).read() requires = [ 'pyramid', 'cornice', 'colander', 'couchdb', ] test_requires = requires + ['lettuce', ] setup(name='daybed', version='0.0', description='daybed', long_description=README + '\n\n' + CHANGES, classifiers=[ "Programming Language :: Python", "Framework :: Pylons", "Topic :: Internet :: WWW/HTTP", "Topic :: Internet :: WWW/HTTP :: WSGI :: Application", ], author='', author_email='', url='', keywords='web pyramid pylons', packages=find_packages(), dependency_links = [ "https://github.com/mozilla-services/cornice/tarball/spore-support#egg=cornice" ], include_package_data=True, zip_safe=False, install_requires=requires, tests_require=test_requires, test_suite="daybed.tests", entry_points="""\ [paste.app_factory] main = daybed:main """, )
import os from setuptools import setup, find_packages here = os.path.abspath(os.path.dirname(__file__)) README = open(os.path.join(here, 'README.rst')).read() CHANGES = open(os.path.join(here, 'CHANGES.rst')).read() requires = [ 'pyramid', 'cornice', 'colander', 'couchdb', ] test_requires = requires + ['lettuce', ] setup(name='daybed', version='0.0', description='daybed', long_description=README + '\n\n' + CHANGES, classifiers=[ "Programming Language :: Python", "Framework :: Pylons", "Topic :: Internet :: WWW/HTTP", "Topic :: Internet :: WWW/HTTP :: WSGI :: Application", ], author='', author_email='', url='', keywords='web pyramid pylons', packages=find_packages(), include_package_data=True, zip_safe=False, install_requires=requires, tests_require=test_requires, test_suite="daybed.tests", entry_points="""\ [paste.app_factory] main = daybed:main """, ) Install the spore branch of corniceimport os from setuptools import setup, find_packages here = os.path.abspath(os.path.dirname(__file__)) README = open(os.path.join(here, 'README.rst')).read() CHANGES = open(os.path.join(here, 'CHANGES.rst')).read() requires = [ 'pyramid', 'cornice', 'colander', 'couchdb', ] test_requires = requires + ['lettuce', ] setup(name='daybed', version='0.0', description='daybed', long_description=README + '\n\n' + CHANGES, classifiers=[ "Programming Language :: Python", "Framework :: Pylons", "Topic :: Internet :: WWW/HTTP", "Topic :: Internet :: WWW/HTTP :: WSGI :: Application", ], author='', author_email='', url='', keywords='web pyramid pylons', packages=find_packages(), dependency_links = [ "https://github.com/mozilla-services/cornice/tarball/spore-support#egg=cornice" ], include_package_data=True, zip_safe=False, install_requires=requires, tests_require=test_requires, test_suite="daybed.tests", entry_points="""\ [paste.app_factory] main = daybed:main """, )
<commit_before>import os from setuptools import setup, find_packages here = os.path.abspath(os.path.dirname(__file__)) README = open(os.path.join(here, 'README.rst')).read() CHANGES = open(os.path.join(here, 'CHANGES.rst')).read() requires = [ 'pyramid', 'cornice', 'colander', 'couchdb', ] test_requires = requires + ['lettuce', ] setup(name='daybed', version='0.0', description='daybed', long_description=README + '\n\n' + CHANGES, classifiers=[ "Programming Language :: Python", "Framework :: Pylons", "Topic :: Internet :: WWW/HTTP", "Topic :: Internet :: WWW/HTTP :: WSGI :: Application", ], author='', author_email='', url='', keywords='web pyramid pylons', packages=find_packages(), include_package_data=True, zip_safe=False, install_requires=requires, tests_require=test_requires, test_suite="daybed.tests", entry_points="""\ [paste.app_factory] main = daybed:main """, ) <commit_msg>Install the spore branch of cornice<commit_after>import os from setuptools import setup, find_packages here = os.path.abspath(os.path.dirname(__file__)) README = open(os.path.join(here, 'README.rst')).read() CHANGES = open(os.path.join(here, 'CHANGES.rst')).read() requires = [ 'pyramid', 'cornice', 'colander', 'couchdb', ] test_requires = requires + ['lettuce', ] setup(name='daybed', version='0.0', description='daybed', long_description=README + '\n\n' + CHANGES, classifiers=[ "Programming Language :: Python", "Framework :: Pylons", "Topic :: Internet :: WWW/HTTP", "Topic :: Internet :: WWW/HTTP :: WSGI :: Application", ], author='', author_email='', url='', keywords='web pyramid pylons', packages=find_packages(), dependency_links = [ "https://github.com/mozilla-services/cornice/tarball/spore-support#egg=cornice" ], include_package_data=True, zip_safe=False, install_requires=requires, tests_require=test_requires, test_suite="daybed.tests", entry_points="""\ [paste.app_factory] main = daybed:main """, )
dcb9850c854733a9e3686548c8e397d4b86c5e3d
setup.py
setup.py
from distutils.core import setup setup( name = 'brazilnum', packages = ['brazilnum'], version = '0.6.1', description = 'Validators for Brazilian CNPJ, CPF, and PIS/PASEP numbers.', author = 'Chris Poliquin', author_email = '[email protected]', url = 'https://github.com/poliquin/brazilnum', keywords = ['brazil', 'cnpj', 'cpf', 'pis', 'pasep'], classifiers = [ 'Programming Language :: Python', 'Programming Language :: Python :: 3', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', 'Topic :: Utilities' ], long_description = """\ Validate Brazilian Identification Numbers ----------------------------------------- Python functions for working with CNPJ, CPF, and PIS/PASEP numbers, which identify firms and people in Brazil. """ )
from distutils.core import setup setup( name = 'brazilnum', packages = ['brazilnum'], version = '0.7.1', description = 'Validators for Brazilian CNPJ, CEI, CPF, and PIS/PASEP', author = 'Chris Poliquin', author_email = '[email protected]', url = 'https://github.com/poliquin/brazilnum', keywords = ['brazil', 'cnpj', 'cei', 'cpf', 'pis', 'pasep'], classifiers = [ 'Programming Language :: Python', 'Programming Language :: Python :: 3', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', 'Topic :: Utilities' ], long_description = """\ Validate Brazilian Identification Numbers ----------------------------------------- Python functions for working with CNPJ, CEI, CPF, and PIS/PASEP numbers, which identify firms and people in Brazil. """ )
Add CEI to package description and bump version
Add CEI to package description and bump version
Python
mit
poliquin/brazilnum
from distutils.core import setup setup( name = 'brazilnum', packages = ['brazilnum'], version = '0.6.1', description = 'Validators for Brazilian CNPJ, CPF, and PIS/PASEP numbers.', author = 'Chris Poliquin', author_email = '[email protected]', url = 'https://github.com/poliquin/brazilnum', keywords = ['brazil', 'cnpj', 'cpf', 'pis', 'pasep'], classifiers = [ 'Programming Language :: Python', 'Programming Language :: Python :: 3', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', 'Topic :: Utilities' ], long_description = """\ Validate Brazilian Identification Numbers ----------------------------------------- Python functions for working with CNPJ, CPF, and PIS/PASEP numbers, which identify firms and people in Brazil. """ ) Add CEI to package description and bump version
from distutils.core import setup setup( name = 'brazilnum', packages = ['brazilnum'], version = '0.7.1', description = 'Validators for Brazilian CNPJ, CEI, CPF, and PIS/PASEP', author = 'Chris Poliquin', author_email = '[email protected]', url = 'https://github.com/poliquin/brazilnum', keywords = ['brazil', 'cnpj', 'cei', 'cpf', 'pis', 'pasep'], classifiers = [ 'Programming Language :: Python', 'Programming Language :: Python :: 3', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', 'Topic :: Utilities' ], long_description = """\ Validate Brazilian Identification Numbers ----------------------------------------- Python functions for working with CNPJ, CEI, CPF, and PIS/PASEP numbers, which identify firms and people in Brazil. """ )
<commit_before>from distutils.core import setup setup( name = 'brazilnum', packages = ['brazilnum'], version = '0.6.1', description = 'Validators for Brazilian CNPJ, CPF, and PIS/PASEP numbers.', author = 'Chris Poliquin', author_email = '[email protected]', url = 'https://github.com/poliquin/brazilnum', keywords = ['brazil', 'cnpj', 'cpf', 'pis', 'pasep'], classifiers = [ 'Programming Language :: Python', 'Programming Language :: Python :: 3', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', 'Topic :: Utilities' ], long_description = """\ Validate Brazilian Identification Numbers ----------------------------------------- Python functions for working with CNPJ, CPF, and PIS/PASEP numbers, which identify firms and people in Brazil. """ ) <commit_msg>Add CEI to package description and bump version<commit_after>
from distutils.core import setup setup( name = 'brazilnum', packages = ['brazilnum'], version = '0.7.1', description = 'Validators for Brazilian CNPJ, CEI, CPF, and PIS/PASEP', author = 'Chris Poliquin', author_email = '[email protected]', url = 'https://github.com/poliquin/brazilnum', keywords = ['brazil', 'cnpj', 'cei', 'cpf', 'pis', 'pasep'], classifiers = [ 'Programming Language :: Python', 'Programming Language :: Python :: 3', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', 'Topic :: Utilities' ], long_description = """\ Validate Brazilian Identification Numbers ----------------------------------------- Python functions for working with CNPJ, CEI, CPF, and PIS/PASEP numbers, which identify firms and people in Brazil. """ )
from distutils.core import setup setup( name = 'brazilnum', packages = ['brazilnum'], version = '0.6.1', description = 'Validators for Brazilian CNPJ, CPF, and PIS/PASEP numbers.', author = 'Chris Poliquin', author_email = '[email protected]', url = 'https://github.com/poliquin/brazilnum', keywords = ['brazil', 'cnpj', 'cpf', 'pis', 'pasep'], classifiers = [ 'Programming Language :: Python', 'Programming Language :: Python :: 3', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', 'Topic :: Utilities' ], long_description = """\ Validate Brazilian Identification Numbers ----------------------------------------- Python functions for working with CNPJ, CPF, and PIS/PASEP numbers, which identify firms and people in Brazil. """ ) Add CEI to package description and bump versionfrom distutils.core import setup setup( name = 'brazilnum', packages = ['brazilnum'], version = '0.7.1', description = 'Validators for Brazilian CNPJ, CEI, CPF, and PIS/PASEP', author = 'Chris Poliquin', author_email = '[email protected]', url = 'https://github.com/poliquin/brazilnum', keywords = ['brazil', 'cnpj', 'cei', 'cpf', 'pis', 'pasep'], classifiers = [ 'Programming Language :: Python', 'Programming Language :: Python :: 3', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', 'Topic :: Utilities' ], long_description = """\ Validate Brazilian Identification Numbers ----------------------------------------- Python functions for working with CNPJ, CEI, CPF, and PIS/PASEP numbers, which identify firms and people in Brazil. """ )
<commit_before>from distutils.core import setup setup( name = 'brazilnum', packages = ['brazilnum'], version = '0.6.1', description = 'Validators for Brazilian CNPJ, CPF, and PIS/PASEP numbers.', author = 'Chris Poliquin', author_email = '[email protected]', url = 'https://github.com/poliquin/brazilnum', keywords = ['brazil', 'cnpj', 'cpf', 'pis', 'pasep'], classifiers = [ 'Programming Language :: Python', 'Programming Language :: Python :: 3', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', 'Topic :: Utilities' ], long_description = """\ Validate Brazilian Identification Numbers ----------------------------------------- Python functions for working with CNPJ, CPF, and PIS/PASEP numbers, which identify firms and people in Brazil. """ ) <commit_msg>Add CEI to package description and bump version<commit_after>from distutils.core import setup setup( name = 'brazilnum', packages = ['brazilnum'], version = '0.7.1', description = 'Validators for Brazilian CNPJ, CEI, CPF, and PIS/PASEP', author = 'Chris Poliquin', author_email = '[email protected]', url = 'https://github.com/poliquin/brazilnum', keywords = ['brazil', 'cnpj', 'cei', 'cpf', 'pis', 'pasep'], classifiers = [ 'Programming Language :: Python', 'Programming Language :: Python :: 3', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', 'Topic :: Utilities' ], long_description = """\ Validate Brazilian Identification Numbers ----------------------------------------- Python functions for working with CNPJ, CEI, CPF, and PIS/PASEP numbers, which identify firms and people in Brazil. """ )
225fd1163a50d4740afdeb21cb94e3f375016e9a
setup.py
setup.py
# -*- coding: utf-8 -*- import os from setuptools import setup import redis_shard def read_file(*path): base_dir = os.path.dirname(__file__) file_path = (base_dir, ) + tuple(path) return open(os.path.join(*file_path)).read() setup( name="redis-shard", url="https://pypi.python.org/pypi/redis-shard", license="BSD", author="Zhihu Inc.", author_email="[email protected]", description="Redis Sharding API", long_description=( read_file("README.rst") + "\n\n" + "Change History\n" + "==============\n\n" + read_file("CHANGES.rst")), version=redis_shard.__version__, packages=["redis_shard"], include_package_data=True, zip_safe=False, install_requires=['redis'], tests_require=['Nose'], classifiers=[ "Development Status :: 5 - Production/Stable", "Intended Audience :: Developers", "Programming Language :: Python", "Programming Language :: Python :: 2", "Programming Language :: Python :: 2.7", "Programming Language :: Python :: 3", "Programming Language :: Python :: 3.3", "Operating System :: OS Independent", "License :: OSI Approved :: BSD License", "Topic :: Software Development :: Libraries", "Topic :: Utilities", ], )
# -*- coding: utf-8 -*- import os from setuptools import setup import redis_shard def read_file(*path): base_dir = os.path.dirname(__file__) file_path = (base_dir, ) + tuple(path) return open(os.path.join(*file_path)).read() setup( name="redis-shard", url="https://pypi.python.org/pypi/redis-shard", license="BSD License", author="Zhihu Inc.", author_email="[email protected]", maintainer="Young King", maintainer_email="[email protected]", description="Redis Sharding API", long_description=( read_file("README.rst") + "\n\n" + "Change History\n" + "==============\n\n" + read_file("CHANGES.rst")), version=redis_shard.__version__, packages=["redis_shard"], include_package_data=True, zip_safe=False, install_requires=['redis'], tests_require=['Nose'], classifiers=[ "Development Status :: 5 - Production/Stable", "Intended Audience :: Developers", "Programming Language :: Python", "Programming Language :: Python :: 2", "Programming Language :: Python :: 2.7", "Programming Language :: Python :: 3", "Programming Language :: Python :: 3.3", "Operating System :: OS Independent", "License :: OSI Approved :: BSD License", "Topic :: Software Development :: Libraries", "Topic :: Utilities", ], )
Update author and maintainer information
Update author and maintainer information
Python
bsd-2-clause
zhihu/redis-shard,keakon/redis-shard
# -*- coding: utf-8 -*- import os from setuptools import setup import redis_shard def read_file(*path): base_dir = os.path.dirname(__file__) file_path = (base_dir, ) + tuple(path) return open(os.path.join(*file_path)).read() setup( name="redis-shard", url="https://pypi.python.org/pypi/redis-shard", license="BSD", author="Zhihu Inc.", author_email="[email protected]", description="Redis Sharding API", long_description=( read_file("README.rst") + "\n\n" + "Change History\n" + "==============\n\n" + read_file("CHANGES.rst")), version=redis_shard.__version__, packages=["redis_shard"], include_package_data=True, zip_safe=False, install_requires=['redis'], tests_require=['Nose'], classifiers=[ "Development Status :: 5 - Production/Stable", "Intended Audience :: Developers", "Programming Language :: Python", "Programming Language :: Python :: 2", "Programming Language :: Python :: 2.7", "Programming Language :: Python :: 3", "Programming Language :: Python :: 3.3", "Operating System :: OS Independent", "License :: OSI Approved :: BSD License", "Topic :: Software Development :: Libraries", "Topic :: Utilities", ], ) Update author and maintainer information
# -*- coding: utf-8 -*- import os from setuptools import setup import redis_shard def read_file(*path): base_dir = os.path.dirname(__file__) file_path = (base_dir, ) + tuple(path) return open(os.path.join(*file_path)).read() setup( name="redis-shard", url="https://pypi.python.org/pypi/redis-shard", license="BSD License", author="Zhihu Inc.", author_email="[email protected]", maintainer="Young King", maintainer_email="[email protected]", description="Redis Sharding API", long_description=( read_file("README.rst") + "\n\n" + "Change History\n" + "==============\n\n" + read_file("CHANGES.rst")), version=redis_shard.__version__, packages=["redis_shard"], include_package_data=True, zip_safe=False, install_requires=['redis'], tests_require=['Nose'], classifiers=[ "Development Status :: 5 - Production/Stable", "Intended Audience :: Developers", "Programming Language :: Python", "Programming Language :: Python :: 2", "Programming Language :: Python :: 2.7", "Programming Language :: Python :: 3", "Programming Language :: Python :: 3.3", "Operating System :: OS Independent", "License :: OSI Approved :: BSD License", "Topic :: Software Development :: Libraries", "Topic :: Utilities", ], )
<commit_before># -*- coding: utf-8 -*- import os from setuptools import setup import redis_shard def read_file(*path): base_dir = os.path.dirname(__file__) file_path = (base_dir, ) + tuple(path) return open(os.path.join(*file_path)).read() setup( name="redis-shard", url="https://pypi.python.org/pypi/redis-shard", license="BSD", author="Zhihu Inc.", author_email="[email protected]", description="Redis Sharding API", long_description=( read_file("README.rst") + "\n\n" + "Change History\n" + "==============\n\n" + read_file("CHANGES.rst")), version=redis_shard.__version__, packages=["redis_shard"], include_package_data=True, zip_safe=False, install_requires=['redis'], tests_require=['Nose'], classifiers=[ "Development Status :: 5 - Production/Stable", "Intended Audience :: Developers", "Programming Language :: Python", "Programming Language :: Python :: 2", "Programming Language :: Python :: 2.7", "Programming Language :: Python :: 3", "Programming Language :: Python :: 3.3", "Operating System :: OS Independent", "License :: OSI Approved :: BSD License", "Topic :: Software Development :: Libraries", "Topic :: Utilities", ], ) <commit_msg>Update author and maintainer information<commit_after>
# -*- coding: utf-8 -*- import os from setuptools import setup import redis_shard def read_file(*path): base_dir = os.path.dirname(__file__) file_path = (base_dir, ) + tuple(path) return open(os.path.join(*file_path)).read() setup( name="redis-shard", url="https://pypi.python.org/pypi/redis-shard", license="BSD License", author="Zhihu Inc.", author_email="[email protected]", maintainer="Young King", maintainer_email="[email protected]", description="Redis Sharding API", long_description=( read_file("README.rst") + "\n\n" + "Change History\n" + "==============\n\n" + read_file("CHANGES.rst")), version=redis_shard.__version__, packages=["redis_shard"], include_package_data=True, zip_safe=False, install_requires=['redis'], tests_require=['Nose'], classifiers=[ "Development Status :: 5 - Production/Stable", "Intended Audience :: Developers", "Programming Language :: Python", "Programming Language :: Python :: 2", "Programming Language :: Python :: 2.7", "Programming Language :: Python :: 3", "Programming Language :: Python :: 3.3", "Operating System :: OS Independent", "License :: OSI Approved :: BSD License", "Topic :: Software Development :: Libraries", "Topic :: Utilities", ], )
# -*- coding: utf-8 -*- import os from setuptools import setup import redis_shard def read_file(*path): base_dir = os.path.dirname(__file__) file_path = (base_dir, ) + tuple(path) return open(os.path.join(*file_path)).read() setup( name="redis-shard", url="https://pypi.python.org/pypi/redis-shard", license="BSD", author="Zhihu Inc.", author_email="[email protected]", description="Redis Sharding API", long_description=( read_file("README.rst") + "\n\n" + "Change History\n" + "==============\n\n" + read_file("CHANGES.rst")), version=redis_shard.__version__, packages=["redis_shard"], include_package_data=True, zip_safe=False, install_requires=['redis'], tests_require=['Nose'], classifiers=[ "Development Status :: 5 - Production/Stable", "Intended Audience :: Developers", "Programming Language :: Python", "Programming Language :: Python :: 2", "Programming Language :: Python :: 2.7", "Programming Language :: Python :: 3", "Programming Language :: Python :: 3.3", "Operating System :: OS Independent", "License :: OSI Approved :: BSD License", "Topic :: Software Development :: Libraries", "Topic :: Utilities", ], ) Update author and maintainer information# -*- coding: utf-8 -*- import os from setuptools import setup import redis_shard def read_file(*path): base_dir = os.path.dirname(__file__) file_path = (base_dir, ) + tuple(path) return open(os.path.join(*file_path)).read() setup( name="redis-shard", url="https://pypi.python.org/pypi/redis-shard", license="BSD License", author="Zhihu Inc.", author_email="[email protected]", maintainer="Young King", maintainer_email="[email protected]", description="Redis Sharding API", long_description=( read_file("README.rst") + "\n\n" + "Change History\n" + "==============\n\n" + read_file("CHANGES.rst")), version=redis_shard.__version__, packages=["redis_shard"], include_package_data=True, zip_safe=False, install_requires=['redis'], tests_require=['Nose'], classifiers=[ "Development Status :: 5 - Production/Stable", "Intended Audience :: Developers", "Programming Language :: Python", "Programming Language :: Python :: 2", "Programming Language :: Python :: 2.7", "Programming Language :: Python :: 3", "Programming Language :: Python :: 3.3", "Operating System :: OS Independent", "License :: OSI Approved :: BSD License", "Topic :: Software Development :: Libraries", "Topic :: Utilities", ], )
<commit_before># -*- coding: utf-8 -*- import os from setuptools import setup import redis_shard def read_file(*path): base_dir = os.path.dirname(__file__) file_path = (base_dir, ) + tuple(path) return open(os.path.join(*file_path)).read() setup( name="redis-shard", url="https://pypi.python.org/pypi/redis-shard", license="BSD", author="Zhihu Inc.", author_email="[email protected]", description="Redis Sharding API", long_description=( read_file("README.rst") + "\n\n" + "Change History\n" + "==============\n\n" + read_file("CHANGES.rst")), version=redis_shard.__version__, packages=["redis_shard"], include_package_data=True, zip_safe=False, install_requires=['redis'], tests_require=['Nose'], classifiers=[ "Development Status :: 5 - Production/Stable", "Intended Audience :: Developers", "Programming Language :: Python", "Programming Language :: Python :: 2", "Programming Language :: Python :: 2.7", "Programming Language :: Python :: 3", "Programming Language :: Python :: 3.3", "Operating System :: OS Independent", "License :: OSI Approved :: BSD License", "Topic :: Software Development :: Libraries", "Topic :: Utilities", ], ) <commit_msg>Update author and maintainer information<commit_after># -*- coding: utf-8 -*- import os from setuptools import setup import redis_shard def read_file(*path): base_dir = os.path.dirname(__file__) file_path = (base_dir, ) + tuple(path) return open(os.path.join(*file_path)).read() setup( name="redis-shard", url="https://pypi.python.org/pypi/redis-shard", license="BSD License", author="Zhihu Inc.", author_email="[email protected]", maintainer="Young King", maintainer_email="[email protected]", description="Redis Sharding API", long_description=( read_file("README.rst") + "\n\n" + "Change History\n" + "==============\n\n" + read_file("CHANGES.rst")), version=redis_shard.__version__, packages=["redis_shard"], include_package_data=True, zip_safe=False, install_requires=['redis'], tests_require=['Nose'], classifiers=[ "Development Status :: 5 - Production/Stable", "Intended Audience :: Developers", "Programming Language :: Python", "Programming Language :: Python :: 2", "Programming Language :: Python :: 2.7", "Programming Language :: Python :: 3", "Programming Language :: Python :: 3.3", "Operating System :: OS Independent", "License :: OSI Approved :: BSD License", "Topic :: Software Development :: Libraries", "Topic :: Utilities", ], )
5d62825d8a49d736496a3f53b3fe43f7a7fa8b09
setup.py
setup.py
from setuptools import setup datafiles = [('/etc', ['general_conf/bck.conf'])] setup( name='mysql-autoxtrabackup', version='1.1', packages=['general_conf', 'backup_prepare', 'partial_recovery', 'master_backup_script'], py_modules = ['autoxtrabackup'], url='https://github.com/ShahriyarR/MySQL-AutoXtraBackup', license='GPL', author='Shahriyar Rzayev', author_email='[email protected]', description='Commandline tool written in Python 3 for using Percona Xtrabackup', install_requires=[ 'click>=3.3', 'mysql-connector-python>=2.0.2', ], dependency_links = ['https://dev.mysql.com/get/Downloads/Connector-Python/mysql-connector-python-2.1.3.tar.gz'], entry_points=''' [console_scripts] autoxtrabackup=autoxtrabackup:all_procedure ''', data_files = datafiles, )
from setuptools import setup datafiles = [('/etc', ['general_conf/bck.conf'])] setup( name='mysql-autoxtrabackup', version='1.1', packages=['general_conf', 'backup_prepare', 'partial_recovery', 'master_backup_script'], py_modules = ['autoxtrabackup'], url='https://github.com/ShahriyarR/MySQL-AutoXtraBackup', license='GPL', author='Shahriyar Rzayev', author_email='[email protected]', description='Commandline tool written in Python 3 for using Percona Xtrabackup', install_requires=[ 'click>=3.3', 'mysql-connector>=2.0.2', ], dependency_links = ['https://dev.mysql.com/get/Downloads/Connector-Python/mysql-connector-python-2.1.3.tar.gz'], entry_points=''' [console_scripts] autoxtrabackup=autoxtrabackup:all_procedure ''', data_files = datafiles, )
Update requirements for correct mysql-connector name
Update requirements for correct mysql-connector name
Python
mit
ShahriyarR/MySQL-AutoXtraBackup,ShahriyarR/MySQL-AutoXtraBackup
from setuptools import setup datafiles = [('/etc', ['general_conf/bck.conf'])] setup( name='mysql-autoxtrabackup', version='1.1', packages=['general_conf', 'backup_prepare', 'partial_recovery', 'master_backup_script'], py_modules = ['autoxtrabackup'], url='https://github.com/ShahriyarR/MySQL-AutoXtraBackup', license='GPL', author='Shahriyar Rzayev', author_email='[email protected]', description='Commandline tool written in Python 3 for using Percona Xtrabackup', install_requires=[ 'click>=3.3', 'mysql-connector-python>=2.0.2', ], dependency_links = ['https://dev.mysql.com/get/Downloads/Connector-Python/mysql-connector-python-2.1.3.tar.gz'], entry_points=''' [console_scripts] autoxtrabackup=autoxtrabackup:all_procedure ''', data_files = datafiles, )Update requirements for correct mysql-connector name
from setuptools import setup datafiles = [('/etc', ['general_conf/bck.conf'])] setup( name='mysql-autoxtrabackup', version='1.1', packages=['general_conf', 'backup_prepare', 'partial_recovery', 'master_backup_script'], py_modules = ['autoxtrabackup'], url='https://github.com/ShahriyarR/MySQL-AutoXtraBackup', license='GPL', author='Shahriyar Rzayev', author_email='[email protected]', description='Commandline tool written in Python 3 for using Percona Xtrabackup', install_requires=[ 'click>=3.3', 'mysql-connector>=2.0.2', ], dependency_links = ['https://dev.mysql.com/get/Downloads/Connector-Python/mysql-connector-python-2.1.3.tar.gz'], entry_points=''' [console_scripts] autoxtrabackup=autoxtrabackup:all_procedure ''', data_files = datafiles, )
<commit_before>from setuptools import setup datafiles = [('/etc', ['general_conf/bck.conf'])] setup( name='mysql-autoxtrabackup', version='1.1', packages=['general_conf', 'backup_prepare', 'partial_recovery', 'master_backup_script'], py_modules = ['autoxtrabackup'], url='https://github.com/ShahriyarR/MySQL-AutoXtraBackup', license='GPL', author='Shahriyar Rzayev', author_email='[email protected]', description='Commandline tool written in Python 3 for using Percona Xtrabackup', install_requires=[ 'click>=3.3', 'mysql-connector-python>=2.0.2', ], dependency_links = ['https://dev.mysql.com/get/Downloads/Connector-Python/mysql-connector-python-2.1.3.tar.gz'], entry_points=''' [console_scripts] autoxtrabackup=autoxtrabackup:all_procedure ''', data_files = datafiles, )<commit_msg>Update requirements for correct mysql-connector name<commit_after>
from setuptools import setup datafiles = [('/etc', ['general_conf/bck.conf'])] setup( name='mysql-autoxtrabackup', version='1.1', packages=['general_conf', 'backup_prepare', 'partial_recovery', 'master_backup_script'], py_modules = ['autoxtrabackup'], url='https://github.com/ShahriyarR/MySQL-AutoXtraBackup', license='GPL', author='Shahriyar Rzayev', author_email='[email protected]', description='Commandline tool written in Python 3 for using Percona Xtrabackup', install_requires=[ 'click>=3.3', 'mysql-connector>=2.0.2', ], dependency_links = ['https://dev.mysql.com/get/Downloads/Connector-Python/mysql-connector-python-2.1.3.tar.gz'], entry_points=''' [console_scripts] autoxtrabackup=autoxtrabackup:all_procedure ''', data_files = datafiles, )
from setuptools import setup datafiles = [('/etc', ['general_conf/bck.conf'])] setup( name='mysql-autoxtrabackup', version='1.1', packages=['general_conf', 'backup_prepare', 'partial_recovery', 'master_backup_script'], py_modules = ['autoxtrabackup'], url='https://github.com/ShahriyarR/MySQL-AutoXtraBackup', license='GPL', author='Shahriyar Rzayev', author_email='[email protected]', description='Commandline tool written in Python 3 for using Percona Xtrabackup', install_requires=[ 'click>=3.3', 'mysql-connector-python>=2.0.2', ], dependency_links = ['https://dev.mysql.com/get/Downloads/Connector-Python/mysql-connector-python-2.1.3.tar.gz'], entry_points=''' [console_scripts] autoxtrabackup=autoxtrabackup:all_procedure ''', data_files = datafiles, )Update requirements for correct mysql-connector namefrom setuptools import setup datafiles = [('/etc', ['general_conf/bck.conf'])] setup( name='mysql-autoxtrabackup', version='1.1', packages=['general_conf', 'backup_prepare', 'partial_recovery', 'master_backup_script'], py_modules = ['autoxtrabackup'], url='https://github.com/ShahriyarR/MySQL-AutoXtraBackup', license='GPL', author='Shahriyar Rzayev', author_email='[email protected]', description='Commandline tool written in Python 3 for using Percona Xtrabackup', install_requires=[ 'click>=3.3', 'mysql-connector>=2.0.2', ], dependency_links = ['https://dev.mysql.com/get/Downloads/Connector-Python/mysql-connector-python-2.1.3.tar.gz'], entry_points=''' [console_scripts] autoxtrabackup=autoxtrabackup:all_procedure ''', data_files = datafiles, )
<commit_before>from setuptools import setup datafiles = [('/etc', ['general_conf/bck.conf'])] setup( name='mysql-autoxtrabackup', version='1.1', packages=['general_conf', 'backup_prepare', 'partial_recovery', 'master_backup_script'], py_modules = ['autoxtrabackup'], url='https://github.com/ShahriyarR/MySQL-AutoXtraBackup', license='GPL', author='Shahriyar Rzayev', author_email='[email protected]', description='Commandline tool written in Python 3 for using Percona Xtrabackup', install_requires=[ 'click>=3.3', 'mysql-connector-python>=2.0.2', ], dependency_links = ['https://dev.mysql.com/get/Downloads/Connector-Python/mysql-connector-python-2.1.3.tar.gz'], entry_points=''' [console_scripts] autoxtrabackup=autoxtrabackup:all_procedure ''', data_files = datafiles, )<commit_msg>Update requirements for correct mysql-connector name<commit_after>from setuptools import setup datafiles = [('/etc', ['general_conf/bck.conf'])] setup( name='mysql-autoxtrabackup', version='1.1', packages=['general_conf', 'backup_prepare', 'partial_recovery', 'master_backup_script'], py_modules = ['autoxtrabackup'], url='https://github.com/ShahriyarR/MySQL-AutoXtraBackup', license='GPL', author='Shahriyar Rzayev', author_email='[email protected]', description='Commandline tool written in Python 3 for using Percona Xtrabackup', install_requires=[ 'click>=3.3', 'mysql-connector>=2.0.2', ], dependency_links = ['https://dev.mysql.com/get/Downloads/Connector-Python/mysql-connector-python-2.1.3.tar.gz'], entry_points=''' [console_scripts] autoxtrabackup=autoxtrabackup:all_procedure ''', data_files = datafiles, )
fa49314b9a97f11bfbd668ae375cd257a59a444b
setup.py
setup.py
# python2.7 setup.py sdist from setuptools import setup setup( name='rpy2_helpers', description='Easier R use from Python', author='Ed L. Cashin', author_email='[email protected]', url='https://github.com/ecashin/rpy2_helpers', version='1.0', install_requires=[ 'click', 'numpy', 'rpy2', ], )
# python2.7 setup.py sdist from setuptools import setup setup( name='rpy2_helpers', description='Easier R use from Python', author='Ed L. Cashin', author_email='[email protected]', url='https://github.com/ecashin/rpy2_helpers', version='0.1', scripts = ['rpy2_helpers.py'], install_requires=[ 'click', 'numpy', 'rpy2', ], )
Switch to a more descriptive version
Switch to a more descriptive version
Python
mit
ecashin/rpy2_helpers
# python2.7 setup.py sdist from setuptools import setup setup( name='rpy2_helpers', description='Easier R use from Python', author='Ed L. Cashin', author_email='[email protected]', url='https://github.com/ecashin/rpy2_helpers', version='1.0', install_requires=[ 'click', 'numpy', 'rpy2', ], ) Switch to a more descriptive version
# python2.7 setup.py sdist from setuptools import setup setup( name='rpy2_helpers', description='Easier R use from Python', author='Ed L. Cashin', author_email='[email protected]', url='https://github.com/ecashin/rpy2_helpers', version='0.1', scripts = ['rpy2_helpers.py'], install_requires=[ 'click', 'numpy', 'rpy2', ], )
<commit_before># python2.7 setup.py sdist from setuptools import setup setup( name='rpy2_helpers', description='Easier R use from Python', author='Ed L. Cashin', author_email='[email protected]', url='https://github.com/ecashin/rpy2_helpers', version='1.0', install_requires=[ 'click', 'numpy', 'rpy2', ], ) <commit_msg>Switch to a more descriptive version<commit_after>
# python2.7 setup.py sdist from setuptools import setup setup( name='rpy2_helpers', description='Easier R use from Python', author='Ed L. Cashin', author_email='[email protected]', url='https://github.com/ecashin/rpy2_helpers', version='0.1', scripts = ['rpy2_helpers.py'], install_requires=[ 'click', 'numpy', 'rpy2', ], )
# python2.7 setup.py sdist from setuptools import setup setup( name='rpy2_helpers', description='Easier R use from Python', author='Ed L. Cashin', author_email='[email protected]', url='https://github.com/ecashin/rpy2_helpers', version='1.0', install_requires=[ 'click', 'numpy', 'rpy2', ], ) Switch to a more descriptive version# python2.7 setup.py sdist from setuptools import setup setup( name='rpy2_helpers', description='Easier R use from Python', author='Ed L. Cashin', author_email='[email protected]', url='https://github.com/ecashin/rpy2_helpers', version='0.1', scripts = ['rpy2_helpers.py'], install_requires=[ 'click', 'numpy', 'rpy2', ], )
<commit_before># python2.7 setup.py sdist from setuptools import setup setup( name='rpy2_helpers', description='Easier R use from Python', author='Ed L. Cashin', author_email='[email protected]', url='https://github.com/ecashin/rpy2_helpers', version='1.0', install_requires=[ 'click', 'numpy', 'rpy2', ], ) <commit_msg>Switch to a more descriptive version<commit_after># python2.7 setup.py sdist from setuptools import setup setup( name='rpy2_helpers', description='Easier R use from Python', author='Ed L. Cashin', author_email='[email protected]', url='https://github.com/ecashin/rpy2_helpers', version='0.1', scripts = ['rpy2_helpers.py'], install_requires=[ 'click', 'numpy', 'rpy2', ], )
566687fef24adaad5e86f1128d1e4e006d266553
setup.py
setup.py
from setuptools import setup, find_packages from suponoff import __version__ as version if __name__ == '__main__': with open("README.rst") as f: long_description = f.read() setup( name="suponoff", version=version, author="Gambit Research", author_email="[email protected]", description="An alternative Supervisor web interface.", long_description=long_description, license="BSD", url="", zip_safe=False, include_package_data=True, packages=find_packages(), scripts=[ 'suponoff-monhelper.py' ], install_requires=[ "Django >= 1.7", # just because I only tested with Django 1.7... ], classifiers=[ "Development Status :: 4 - Beta", "Environment :: Web Environment", "Framework :: Django", "Intended Audience :: Developers", "License :: OSI Approved :: BSD License", "Operating System :: Linux", "Programming Language :: Python", "Programming Language :: Python :: 3", "Programming Language :: Python :: 3.3", "Topic :: Internet :: WWW/HTTP", "Topic :: Internet :: WWW/HTTP :: Dynamic Content", "Topic :: Internet :: WWW/HTTP :: WSGI", ("Topic :: Software Development :: Libraries :: " "Application Frameworks"), "Topic :: Software Development :: Libraries :: Python Modules", ])
from setuptools import setup, find_packages from suponoff import __version__ as version if __name__ == '__main__': with open("README.rst") as f: long_description = f.read() setup( name="suponoff", version=version, author="Gambit Research", author_email="[email protected]", description="An alternative Supervisor web interface.", long_description=long_description, license="BSD", url="", zip_safe=False, include_package_data=True, packages=find_packages(), scripts=[ 'suponoff-monhelper.py' ], install_requires=[ "Django >= 1.7", # just because I only tested with Django 1.7... ], classifiers=[ "Development Status :: 4 - Beta", "Environment :: Web Environment", "Framework :: Django", "Intended Audience :: Developers", "License :: OSI Approved :: BSD License", "Operating System :: Linux", "Programming Language :: Python", "Programming Language :: Python :: 3", "Programming Language :: Python :: 3.3", "Topic :: Internet :: WWW/HTTP", "Topic :: Internet :: WWW/HTTP :: Dynamic Content", "Topic :: Internet :: WWW/HTTP :: WSGI", ("Topic :: Software Development :: Libraries :: " "Application Frameworks"), "Topic :: Software Development :: Libraries :: Python Modules", ])
Correct the author email address
Correct the author email address
Python
bsd-2-clause
GambitResearch/suponoff,lciti/suponoff,lciti/suponoff,GambitResearch/suponoff,GambitResearch/suponoff,lciti/suponoff
from setuptools import setup, find_packages from suponoff import __version__ as version if __name__ == '__main__': with open("README.rst") as f: long_description = f.read() setup( name="suponoff", version=version, author="Gambit Research", author_email="[email protected]", description="An alternative Supervisor web interface.", long_description=long_description, license="BSD", url="", zip_safe=False, include_package_data=True, packages=find_packages(), scripts=[ 'suponoff-monhelper.py' ], install_requires=[ "Django >= 1.7", # just because I only tested with Django 1.7... ], classifiers=[ "Development Status :: 4 - Beta", "Environment :: Web Environment", "Framework :: Django", "Intended Audience :: Developers", "License :: OSI Approved :: BSD License", "Operating System :: Linux", "Programming Language :: Python", "Programming Language :: Python :: 3", "Programming Language :: Python :: 3.3", "Topic :: Internet :: WWW/HTTP", "Topic :: Internet :: WWW/HTTP :: Dynamic Content", "Topic :: Internet :: WWW/HTTP :: WSGI", ("Topic :: Software Development :: Libraries :: " "Application Frameworks"), "Topic :: Software Development :: Libraries :: Python Modules", ]) Correct the author email address
from setuptools import setup, find_packages from suponoff import __version__ as version if __name__ == '__main__': with open("README.rst") as f: long_description = f.read() setup( name="suponoff", version=version, author="Gambit Research", author_email="[email protected]", description="An alternative Supervisor web interface.", long_description=long_description, license="BSD", url="", zip_safe=False, include_package_data=True, packages=find_packages(), scripts=[ 'suponoff-monhelper.py' ], install_requires=[ "Django >= 1.7", # just because I only tested with Django 1.7... ], classifiers=[ "Development Status :: 4 - Beta", "Environment :: Web Environment", "Framework :: Django", "Intended Audience :: Developers", "License :: OSI Approved :: BSD License", "Operating System :: Linux", "Programming Language :: Python", "Programming Language :: Python :: 3", "Programming Language :: Python :: 3.3", "Topic :: Internet :: WWW/HTTP", "Topic :: Internet :: WWW/HTTP :: Dynamic Content", "Topic :: Internet :: WWW/HTTP :: WSGI", ("Topic :: Software Development :: Libraries :: " "Application Frameworks"), "Topic :: Software Development :: Libraries :: Python Modules", ])
<commit_before>from setuptools import setup, find_packages from suponoff import __version__ as version if __name__ == '__main__': with open("README.rst") as f: long_description = f.read() setup( name="suponoff", version=version, author="Gambit Research", author_email="[email protected]", description="An alternative Supervisor web interface.", long_description=long_description, license="BSD", url="", zip_safe=False, include_package_data=True, packages=find_packages(), scripts=[ 'suponoff-monhelper.py' ], install_requires=[ "Django >= 1.7", # just because I only tested with Django 1.7... ], classifiers=[ "Development Status :: 4 - Beta", "Environment :: Web Environment", "Framework :: Django", "Intended Audience :: Developers", "License :: OSI Approved :: BSD License", "Operating System :: Linux", "Programming Language :: Python", "Programming Language :: Python :: 3", "Programming Language :: Python :: 3.3", "Topic :: Internet :: WWW/HTTP", "Topic :: Internet :: WWW/HTTP :: Dynamic Content", "Topic :: Internet :: WWW/HTTP :: WSGI", ("Topic :: Software Development :: Libraries :: " "Application Frameworks"), "Topic :: Software Development :: Libraries :: Python Modules", ]) <commit_msg>Correct the author email address<commit_after>
from setuptools import setup, find_packages from suponoff import __version__ as version if __name__ == '__main__': with open("README.rst") as f: long_description = f.read() setup( name="suponoff", version=version, author="Gambit Research", author_email="[email protected]", description="An alternative Supervisor web interface.", long_description=long_description, license="BSD", url="", zip_safe=False, include_package_data=True, packages=find_packages(), scripts=[ 'suponoff-monhelper.py' ], install_requires=[ "Django >= 1.7", # just because I only tested with Django 1.7... ], classifiers=[ "Development Status :: 4 - Beta", "Environment :: Web Environment", "Framework :: Django", "Intended Audience :: Developers", "License :: OSI Approved :: BSD License", "Operating System :: Linux", "Programming Language :: Python", "Programming Language :: Python :: 3", "Programming Language :: Python :: 3.3", "Topic :: Internet :: WWW/HTTP", "Topic :: Internet :: WWW/HTTP :: Dynamic Content", "Topic :: Internet :: WWW/HTTP :: WSGI", ("Topic :: Software Development :: Libraries :: " "Application Frameworks"), "Topic :: Software Development :: Libraries :: Python Modules", ])
from setuptools import setup, find_packages from suponoff import __version__ as version if __name__ == '__main__': with open("README.rst") as f: long_description = f.read() setup( name="suponoff", version=version, author="Gambit Research", author_email="[email protected]", description="An alternative Supervisor web interface.", long_description=long_description, license="BSD", url="", zip_safe=False, include_package_data=True, packages=find_packages(), scripts=[ 'suponoff-monhelper.py' ], install_requires=[ "Django >= 1.7", # just because I only tested with Django 1.7... ], classifiers=[ "Development Status :: 4 - Beta", "Environment :: Web Environment", "Framework :: Django", "Intended Audience :: Developers", "License :: OSI Approved :: BSD License", "Operating System :: Linux", "Programming Language :: Python", "Programming Language :: Python :: 3", "Programming Language :: Python :: 3.3", "Topic :: Internet :: WWW/HTTP", "Topic :: Internet :: WWW/HTTP :: Dynamic Content", "Topic :: Internet :: WWW/HTTP :: WSGI", ("Topic :: Software Development :: Libraries :: " "Application Frameworks"), "Topic :: Software Development :: Libraries :: Python Modules", ]) Correct the author email addressfrom setuptools import setup, find_packages from suponoff import __version__ as version if __name__ == '__main__': with open("README.rst") as f: long_description = f.read() setup( name="suponoff", version=version, author="Gambit Research", author_email="[email protected]", description="An alternative Supervisor web interface.", long_description=long_description, license="BSD", url="", zip_safe=False, include_package_data=True, packages=find_packages(), scripts=[ 'suponoff-monhelper.py' ], install_requires=[ "Django >= 1.7", # just because I only tested with Django 1.7... ], classifiers=[ "Development Status :: 4 - Beta", "Environment :: Web Environment", "Framework :: Django", "Intended Audience :: Developers", "License :: OSI Approved :: BSD License", "Operating System :: Linux", "Programming Language :: Python", "Programming Language :: Python :: 3", "Programming Language :: Python :: 3.3", "Topic :: Internet :: WWW/HTTP", "Topic :: Internet :: WWW/HTTP :: Dynamic Content", "Topic :: Internet :: WWW/HTTP :: WSGI", ("Topic :: Software Development :: Libraries :: " "Application Frameworks"), "Topic :: Software Development :: Libraries :: Python Modules", ])
<commit_before>from setuptools import setup, find_packages from suponoff import __version__ as version if __name__ == '__main__': with open("README.rst") as f: long_description = f.read() setup( name="suponoff", version=version, author="Gambit Research", author_email="[email protected]", description="An alternative Supervisor web interface.", long_description=long_description, license="BSD", url="", zip_safe=False, include_package_data=True, packages=find_packages(), scripts=[ 'suponoff-monhelper.py' ], install_requires=[ "Django >= 1.7", # just because I only tested with Django 1.7... ], classifiers=[ "Development Status :: 4 - Beta", "Environment :: Web Environment", "Framework :: Django", "Intended Audience :: Developers", "License :: OSI Approved :: BSD License", "Operating System :: Linux", "Programming Language :: Python", "Programming Language :: Python :: 3", "Programming Language :: Python :: 3.3", "Topic :: Internet :: WWW/HTTP", "Topic :: Internet :: WWW/HTTP :: Dynamic Content", "Topic :: Internet :: WWW/HTTP :: WSGI", ("Topic :: Software Development :: Libraries :: " "Application Frameworks"), "Topic :: Software Development :: Libraries :: Python Modules", ]) <commit_msg>Correct the author email address<commit_after>from setuptools import setup, find_packages from suponoff import __version__ as version if __name__ == '__main__': with open("README.rst") as f: long_description = f.read() setup( name="suponoff", version=version, author="Gambit Research", author_email="[email protected]", description="An alternative Supervisor web interface.", long_description=long_description, license="BSD", url="", zip_safe=False, include_package_data=True, packages=find_packages(), scripts=[ 'suponoff-monhelper.py' ], install_requires=[ "Django >= 1.7", # just because I only tested with Django 1.7... ], classifiers=[ "Development Status :: 4 - Beta", "Environment :: Web Environment", "Framework :: Django", "Intended Audience :: Developers", "License :: OSI Approved :: BSD License", "Operating System :: Linux", "Programming Language :: Python", "Programming Language :: Python :: 3", "Programming Language :: Python :: 3.3", "Topic :: Internet :: WWW/HTTP", "Topic :: Internet :: WWW/HTTP :: Dynamic Content", "Topic :: Internet :: WWW/HTTP :: WSGI", ("Topic :: Software Development :: Libraries :: " "Application Frameworks"), "Topic :: Software Development :: Libraries :: Python Modules", ])
9dee9d6ba135ccba01ed4913b30a51a9ad9b326f
setup.py
setup.py
from setuptools import setup, find_packages setup( name='dict-utils', version='0.1', url='https://www.github.com/andreagrandi/dicts-utils/', author='Andrea Grandi', author_email='[email protected]', description='Simple framework for creating REST APIs', packages=find_packages(exclude=['tests']), zip_safe=False, include_package_data=True, platforms='any', test_suite = 'tests.test_dict_utils' )
from setuptools import setup, find_packages setup( name='dict-utils', version='0.1', url='https://www.github.com/andreagrandi/dict-utils/', author='Andrea Grandi', author_email='[email protected]', description='Set of utilities and accessory methods to work with Python dicts.', packages=find_packages(exclude=['tests']), zip_safe=False, include_package_data=True, platforms='any', test_suite = 'tests.test_dict_utils' )
Fix a typo and project description
Fix a typo and project description
Python
mit
glowdigitalmedia/dict-utils
from setuptools import setup, find_packages setup( name='dict-utils', version='0.1', url='https://www.github.com/andreagrandi/dicts-utils/', author='Andrea Grandi', author_email='[email protected]', description='Simple framework for creating REST APIs', packages=find_packages(exclude=['tests']), zip_safe=False, include_package_data=True, platforms='any', test_suite = 'tests.test_dict_utils' ) Fix a typo and project description
from setuptools import setup, find_packages setup( name='dict-utils', version='0.1', url='https://www.github.com/andreagrandi/dict-utils/', author='Andrea Grandi', author_email='[email protected]', description='Set of utilities and accessory methods to work with Python dicts.', packages=find_packages(exclude=['tests']), zip_safe=False, include_package_data=True, platforms='any', test_suite = 'tests.test_dict_utils' )
<commit_before>from setuptools import setup, find_packages setup( name='dict-utils', version='0.1', url='https://www.github.com/andreagrandi/dicts-utils/', author='Andrea Grandi', author_email='[email protected]', description='Simple framework for creating REST APIs', packages=find_packages(exclude=['tests']), zip_safe=False, include_package_data=True, platforms='any', test_suite = 'tests.test_dict_utils' ) <commit_msg>Fix a typo and project description<commit_after>
from setuptools import setup, find_packages setup( name='dict-utils', version='0.1', url='https://www.github.com/andreagrandi/dict-utils/', author='Andrea Grandi', author_email='[email protected]', description='Set of utilities and accessory methods to work with Python dicts.', packages=find_packages(exclude=['tests']), zip_safe=False, include_package_data=True, platforms='any', test_suite = 'tests.test_dict_utils' )
from setuptools import setup, find_packages setup( name='dict-utils', version='0.1', url='https://www.github.com/andreagrandi/dicts-utils/', author='Andrea Grandi', author_email='[email protected]', description='Simple framework for creating REST APIs', packages=find_packages(exclude=['tests']), zip_safe=False, include_package_data=True, platforms='any', test_suite = 'tests.test_dict_utils' ) Fix a typo and project descriptionfrom setuptools import setup, find_packages setup( name='dict-utils', version='0.1', url='https://www.github.com/andreagrandi/dict-utils/', author='Andrea Grandi', author_email='[email protected]', description='Set of utilities and accessory methods to work with Python dicts.', packages=find_packages(exclude=['tests']), zip_safe=False, include_package_data=True, platforms='any', test_suite = 'tests.test_dict_utils' )
<commit_before>from setuptools import setup, find_packages setup( name='dict-utils', version='0.1', url='https://www.github.com/andreagrandi/dicts-utils/', author='Andrea Grandi', author_email='[email protected]', description='Simple framework for creating REST APIs', packages=find_packages(exclude=['tests']), zip_safe=False, include_package_data=True, platforms='any', test_suite = 'tests.test_dict_utils' ) <commit_msg>Fix a typo and project description<commit_after>from setuptools import setup, find_packages setup( name='dict-utils', version='0.1', url='https://www.github.com/andreagrandi/dict-utils/', author='Andrea Grandi', author_email='[email protected]', description='Set of utilities and accessory methods to work with Python dicts.', packages=find_packages(exclude=['tests']), zip_safe=False, include_package_data=True, platforms='any', test_suite = 'tests.test_dict_utils' )
cd8b8cca55572dfe8e3bf97976f70ee2d62b1323
setup.py
setup.py
from setuptools import setup, Extension module1 = Extension('earl', sources = ['earl.cpp']) setup ( name = "earl-etf", version = "2.0.2", description = "Earl-etf, the fanciest External Term Format packer and unpacker available for Python.", ext_modules = [module1], url="https://github.com/ccubed/Earl", author="Charles Click", author_email="[email protected]", license="MIT", keywords="Erlang ETF External Term Format" )
from setuptools import setup, Extension module1 = Extension('earl', sources = ['earl.cpp']) setup ( name = "earl-etf", version = "2.1.2", description = "Earl-etf, the fanciest External Term Format packer and unpacker available for Python.", ext_modules = [module1], url="https://github.com/ccubed/Earl", author="Charles Click", author_email="[email protected]", license="MIT", keywords="Erlang ETF External Term Format" )
Bump version and compile new wheels for pypy
Bump version and compile new wheels for pypy
Python
mit
ccubed/Earl,ccubed/Earl
from setuptools import setup, Extension module1 = Extension('earl', sources = ['earl.cpp']) setup ( name = "earl-etf", version = "2.0.2", description = "Earl-etf, the fanciest External Term Format packer and unpacker available for Python.", ext_modules = [module1], url="https://github.com/ccubed/Earl", author="Charles Click", author_email="[email protected]", license="MIT", keywords="Erlang ETF External Term Format" ) Bump version and compile new wheels for pypy
from setuptools import setup, Extension module1 = Extension('earl', sources = ['earl.cpp']) setup ( name = "earl-etf", version = "2.1.2", description = "Earl-etf, the fanciest External Term Format packer and unpacker available for Python.", ext_modules = [module1], url="https://github.com/ccubed/Earl", author="Charles Click", author_email="[email protected]", license="MIT", keywords="Erlang ETF External Term Format" )
<commit_before>from setuptools import setup, Extension module1 = Extension('earl', sources = ['earl.cpp']) setup ( name = "earl-etf", version = "2.0.2", description = "Earl-etf, the fanciest External Term Format packer and unpacker available for Python.", ext_modules = [module1], url="https://github.com/ccubed/Earl", author="Charles Click", author_email="[email protected]", license="MIT", keywords="Erlang ETF External Term Format" ) <commit_msg>Bump version and compile new wheels for pypy<commit_after>
from setuptools import setup, Extension module1 = Extension('earl', sources = ['earl.cpp']) setup ( name = "earl-etf", version = "2.1.2", description = "Earl-etf, the fanciest External Term Format packer and unpacker available for Python.", ext_modules = [module1], url="https://github.com/ccubed/Earl", author="Charles Click", author_email="[email protected]", license="MIT", keywords="Erlang ETF External Term Format" )
from setuptools import setup, Extension module1 = Extension('earl', sources = ['earl.cpp']) setup ( name = "earl-etf", version = "2.0.2", description = "Earl-etf, the fanciest External Term Format packer and unpacker available for Python.", ext_modules = [module1], url="https://github.com/ccubed/Earl", author="Charles Click", author_email="[email protected]", license="MIT", keywords="Erlang ETF External Term Format" ) Bump version and compile new wheels for pypyfrom setuptools import setup, Extension module1 = Extension('earl', sources = ['earl.cpp']) setup ( name = "earl-etf", version = "2.1.2", description = "Earl-etf, the fanciest External Term Format packer and unpacker available for Python.", ext_modules = [module1], url="https://github.com/ccubed/Earl", author="Charles Click", author_email="[email protected]", license="MIT", keywords="Erlang ETF External Term Format" )
<commit_before>from setuptools import setup, Extension module1 = Extension('earl', sources = ['earl.cpp']) setup ( name = "earl-etf", version = "2.0.2", description = "Earl-etf, the fanciest External Term Format packer and unpacker available for Python.", ext_modules = [module1], url="https://github.com/ccubed/Earl", author="Charles Click", author_email="[email protected]", license="MIT", keywords="Erlang ETF External Term Format" ) <commit_msg>Bump version and compile new wheels for pypy<commit_after>from setuptools import setup, Extension module1 = Extension('earl', sources = ['earl.cpp']) setup ( name = "earl-etf", version = "2.1.2", description = "Earl-etf, the fanciest External Term Format packer and unpacker available for Python.", ext_modules = [module1], url="https://github.com/ccubed/Earl", author="Charles Click", author_email="[email protected]", license="MIT", keywords="Erlang ETF External Term Format" )
b2e85641a87c647132cc8938b470c7bd9ddedb0b
setup.py
setup.py
#!/usr/bin/env python from setuptools import setup setup( name='mass', version='0.0.1', description='Watches your javascript', author='Jack Boberg & Alex Padgett', author_email='[email protected]', url='https://github.com/jackboberg/jswatchr', packages=['mass'], install_requires=['distribute','jsmin','macfsevents'], zip_safe = False, entry_points = { 'console_scripts': [ "mass = jswatchr.monitor:main" ], } )
#!/usr/bin/env python from setuptools import setup setup( name='mass', version='0.0.1', description='Watches your javascript', author='Jack Boberg & Alex Padgett', author_email='[email protected]', url='https://github.com/jackboberg/jswatchr', packages=['mass'], install_requires=['distribute','jsmin','macfsevents'], zip_safe = False, entry_points = { 'console_scripts': [ "mass = mass.monitor:main" ], } )
Fix entry point reference to mass
Fix entry point reference to mass
Python
bsd-2-clause
coded-by-hand/mass,coded-by-hand/mass
#!/usr/bin/env python from setuptools import setup setup( name='mass', version='0.0.1', description='Watches your javascript', author='Jack Boberg & Alex Padgett', author_email='[email protected]', url='https://github.com/jackboberg/jswatchr', packages=['mass'], install_requires=['distribute','jsmin','macfsevents'], zip_safe = False, entry_points = { 'console_scripts': [ "mass = jswatchr.monitor:main" ], } ) Fix entry point reference to mass
#!/usr/bin/env python from setuptools import setup setup( name='mass', version='0.0.1', description='Watches your javascript', author='Jack Boberg & Alex Padgett', author_email='[email protected]', url='https://github.com/jackboberg/jswatchr', packages=['mass'], install_requires=['distribute','jsmin','macfsevents'], zip_safe = False, entry_points = { 'console_scripts': [ "mass = mass.monitor:main" ], } )
<commit_before>#!/usr/bin/env python from setuptools import setup setup( name='mass', version='0.0.1', description='Watches your javascript', author='Jack Boberg & Alex Padgett', author_email='[email protected]', url='https://github.com/jackboberg/jswatchr', packages=['mass'], install_requires=['distribute','jsmin','macfsevents'], zip_safe = False, entry_points = { 'console_scripts': [ "mass = jswatchr.monitor:main" ], } ) <commit_msg>Fix entry point reference to mass<commit_after>
#!/usr/bin/env python from setuptools import setup setup( name='mass', version='0.0.1', description='Watches your javascript', author='Jack Boberg & Alex Padgett', author_email='[email protected]', url='https://github.com/jackboberg/jswatchr', packages=['mass'], install_requires=['distribute','jsmin','macfsevents'], zip_safe = False, entry_points = { 'console_scripts': [ "mass = mass.monitor:main" ], } )
#!/usr/bin/env python from setuptools import setup setup( name='mass', version='0.0.1', description='Watches your javascript', author='Jack Boberg & Alex Padgett', author_email='[email protected]', url='https://github.com/jackboberg/jswatchr', packages=['mass'], install_requires=['distribute','jsmin','macfsevents'], zip_safe = False, entry_points = { 'console_scripts': [ "mass = jswatchr.monitor:main" ], } ) Fix entry point reference to mass#!/usr/bin/env python from setuptools import setup setup( name='mass', version='0.0.1', description='Watches your javascript', author='Jack Boberg & Alex Padgett', author_email='[email protected]', url='https://github.com/jackboberg/jswatchr', packages=['mass'], install_requires=['distribute','jsmin','macfsevents'], zip_safe = False, entry_points = { 'console_scripts': [ "mass = mass.monitor:main" ], } )
<commit_before>#!/usr/bin/env python from setuptools import setup setup( name='mass', version='0.0.1', description='Watches your javascript', author='Jack Boberg & Alex Padgett', author_email='[email protected]', url='https://github.com/jackboberg/jswatchr', packages=['mass'], install_requires=['distribute','jsmin','macfsevents'], zip_safe = False, entry_points = { 'console_scripts': [ "mass = jswatchr.monitor:main" ], } ) <commit_msg>Fix entry point reference to mass<commit_after>#!/usr/bin/env python from setuptools import setup setup( name='mass', version='0.0.1', description='Watches your javascript', author='Jack Boberg & Alex Padgett', author_email='[email protected]', url='https://github.com/jackboberg/jswatchr', packages=['mass'], install_requires=['distribute','jsmin','macfsevents'], zip_safe = False, entry_points = { 'console_scripts': [ "mass = mass.monitor:main" ], } )
9aebd808c50faa0ef7801bd5f9795d0dbffa1752
setup.py
setup.py
from distutils.core import setup import skyfield # to learn the version setup( name='skyfield', version=skyfield.__version__, description=skyfield.__doc__, long_description=open('README.rst').read(), license='MIT', author='Brandon Rhodes', author_email='[email protected]', url='http://github.com/brandon-rhodes/python-skyfield/', classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Science/Research', 'License :: OSI Approved :: MIT License', 'Topic :: Scientific/Engineering :: Astronomy', ], packages=[ 'skyfield', 'skyfield.data', 'skyfield.tests', ], package_data = { 'skyfield': ['documentation/*.rst'], 'skyfield.data': ['*.npy'], }, install_requires=[ 'de421==2008.1', 'jplephem>=1.2', 'numpy', 'requests>=1.2.3', 'sgp4>=1.1', ])
from distutils.core import setup import skyfield # to learn the version setup( name='skyfield', version=skyfield.__version__, description=skyfield.__doc__, long_description=open('README.rst').read(), license='MIT', author='Brandon Rhodes', author_email='[email protected]', url='http://github.com/brandon-rhodes/python-skyfield/', classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Science/Research', 'License :: OSI Approved :: MIT License', 'Topic :: Scientific/Engineering :: Astronomy', ], packages=[ 'skyfield', 'skyfield.data', 'skyfield.tests', ], package_data = { 'skyfield': ['documentation/*.rst'], 'skyfield.data': ['*.npy', '*.txt'], }, install_requires=[ 'de421==2008.1', 'jplephem>=1.2', 'numpy', 'requests>=1.2.3', 'sgp4>=1.1', ])
Include last data-cache build-date file in package
Include last data-cache build-date file in package
Python
mit
exoanalytic/python-skyfield,skyfielders/python-skyfield,ozialien/python-skyfield,skyfielders/python-skyfield,exoanalytic/python-skyfield,GuidoBR/python-skyfield,ozialien/python-skyfield,GuidoBR/python-skyfield
from distutils.core import setup import skyfield # to learn the version setup( name='skyfield', version=skyfield.__version__, description=skyfield.__doc__, long_description=open('README.rst').read(), license='MIT', author='Brandon Rhodes', author_email='[email protected]', url='http://github.com/brandon-rhodes/python-skyfield/', classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Science/Research', 'License :: OSI Approved :: MIT License', 'Topic :: Scientific/Engineering :: Astronomy', ], packages=[ 'skyfield', 'skyfield.data', 'skyfield.tests', ], package_data = { 'skyfield': ['documentation/*.rst'], 'skyfield.data': ['*.npy'], }, install_requires=[ 'de421==2008.1', 'jplephem>=1.2', 'numpy', 'requests>=1.2.3', 'sgp4>=1.1', ]) Include last data-cache build-date file in package
from distutils.core import setup import skyfield # to learn the version setup( name='skyfield', version=skyfield.__version__, description=skyfield.__doc__, long_description=open('README.rst').read(), license='MIT', author='Brandon Rhodes', author_email='[email protected]', url='http://github.com/brandon-rhodes/python-skyfield/', classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Science/Research', 'License :: OSI Approved :: MIT License', 'Topic :: Scientific/Engineering :: Astronomy', ], packages=[ 'skyfield', 'skyfield.data', 'skyfield.tests', ], package_data = { 'skyfield': ['documentation/*.rst'], 'skyfield.data': ['*.npy', '*.txt'], }, install_requires=[ 'de421==2008.1', 'jplephem>=1.2', 'numpy', 'requests>=1.2.3', 'sgp4>=1.1', ])
<commit_before>from distutils.core import setup import skyfield # to learn the version setup( name='skyfield', version=skyfield.__version__, description=skyfield.__doc__, long_description=open('README.rst').read(), license='MIT', author='Brandon Rhodes', author_email='[email protected]', url='http://github.com/brandon-rhodes/python-skyfield/', classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Science/Research', 'License :: OSI Approved :: MIT License', 'Topic :: Scientific/Engineering :: Astronomy', ], packages=[ 'skyfield', 'skyfield.data', 'skyfield.tests', ], package_data = { 'skyfield': ['documentation/*.rst'], 'skyfield.data': ['*.npy'], }, install_requires=[ 'de421==2008.1', 'jplephem>=1.2', 'numpy', 'requests>=1.2.3', 'sgp4>=1.1', ]) <commit_msg>Include last data-cache build-date file in package<commit_after>
from distutils.core import setup import skyfield # to learn the version setup( name='skyfield', version=skyfield.__version__, description=skyfield.__doc__, long_description=open('README.rst').read(), license='MIT', author='Brandon Rhodes', author_email='[email protected]', url='http://github.com/brandon-rhodes/python-skyfield/', classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Science/Research', 'License :: OSI Approved :: MIT License', 'Topic :: Scientific/Engineering :: Astronomy', ], packages=[ 'skyfield', 'skyfield.data', 'skyfield.tests', ], package_data = { 'skyfield': ['documentation/*.rst'], 'skyfield.data': ['*.npy', '*.txt'], }, install_requires=[ 'de421==2008.1', 'jplephem>=1.2', 'numpy', 'requests>=1.2.3', 'sgp4>=1.1', ])
from distutils.core import setup import skyfield # to learn the version setup( name='skyfield', version=skyfield.__version__, description=skyfield.__doc__, long_description=open('README.rst').read(), license='MIT', author='Brandon Rhodes', author_email='[email protected]', url='http://github.com/brandon-rhodes/python-skyfield/', classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Science/Research', 'License :: OSI Approved :: MIT License', 'Topic :: Scientific/Engineering :: Astronomy', ], packages=[ 'skyfield', 'skyfield.data', 'skyfield.tests', ], package_data = { 'skyfield': ['documentation/*.rst'], 'skyfield.data': ['*.npy'], }, install_requires=[ 'de421==2008.1', 'jplephem>=1.2', 'numpy', 'requests>=1.2.3', 'sgp4>=1.1', ]) Include last data-cache build-date file in packagefrom distutils.core import setup import skyfield # to learn the version setup( name='skyfield', version=skyfield.__version__, description=skyfield.__doc__, long_description=open('README.rst').read(), license='MIT', author='Brandon Rhodes', author_email='[email protected]', url='http://github.com/brandon-rhodes/python-skyfield/', classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Science/Research', 'License :: OSI Approved :: MIT License', 'Topic :: Scientific/Engineering :: Astronomy', ], packages=[ 'skyfield', 'skyfield.data', 'skyfield.tests', ], package_data = { 'skyfield': ['documentation/*.rst'], 'skyfield.data': ['*.npy', '*.txt'], }, install_requires=[ 'de421==2008.1', 'jplephem>=1.2', 'numpy', 'requests>=1.2.3', 'sgp4>=1.1', ])
<commit_before>from distutils.core import setup import skyfield # to learn the version setup( name='skyfield', version=skyfield.__version__, description=skyfield.__doc__, long_description=open('README.rst').read(), license='MIT', author='Brandon Rhodes', author_email='[email protected]', url='http://github.com/brandon-rhodes/python-skyfield/', classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Science/Research', 'License :: OSI Approved :: MIT License', 'Topic :: Scientific/Engineering :: Astronomy', ], packages=[ 'skyfield', 'skyfield.data', 'skyfield.tests', ], package_data = { 'skyfield': ['documentation/*.rst'], 'skyfield.data': ['*.npy'], }, install_requires=[ 'de421==2008.1', 'jplephem>=1.2', 'numpy', 'requests>=1.2.3', 'sgp4>=1.1', ]) <commit_msg>Include last data-cache build-date file in package<commit_after>from distutils.core import setup import skyfield # to learn the version setup( name='skyfield', version=skyfield.__version__, description=skyfield.__doc__, long_description=open('README.rst').read(), license='MIT', author='Brandon Rhodes', author_email='[email protected]', url='http://github.com/brandon-rhodes/python-skyfield/', classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Science/Research', 'License :: OSI Approved :: MIT License', 'Topic :: Scientific/Engineering :: Astronomy', ], packages=[ 'skyfield', 'skyfield.data', 'skyfield.tests', ], package_data = { 'skyfield': ['documentation/*.rst'], 'skyfield.data': ['*.npy', '*.txt'], }, install_requires=[ 'de421==2008.1', 'jplephem>=1.2', 'numpy', 'requests>=1.2.3', 'sgp4>=1.1', ])
1b5f4e5777ddefa1124d665cdfc37d982f480f6b
setup.py
setup.py
#! /usr/bin/env python from setuptools import setup, Extension pyasmjit_module = Extension( 'pyasmjit.pyasmjit', sources = [ 'pyasmjit/pyasmjit.c' ], ) setup( author = 'Christian Heitman', author_email = '[email protected]', description = 'PyAsmJIT', ext_modules = [ pyasmjit_module ], license = 'BSD 2-Clause', name = 'pyasmjit', version = '0.1', )
#! /usr/bin/env python from setuptools import setup, Extension pyasmjit_module = Extension( 'pyasmjit.pyasmjit', sources = [ 'pyasmjit/pyasmjit.c' ], ) setup( author = 'Christian Heitman', author_email = '[email protected]', description = 'PyAsmJIT', ext_modules = [ pyasmjit_module ], license = 'BSD 2-Clause', name = 'pyasmjit', url = 'http://github.com/programa-stic/barf-project', version = '0.2', )
Update README. Add global change log file. Update version number.
Update README. Add global change log file. Update version number.
Python
bsd-2-clause
programa-stic/pyasmjit,programa-stic/pyasmjit
#! /usr/bin/env python from setuptools import setup, Extension pyasmjit_module = Extension( 'pyasmjit.pyasmjit', sources = [ 'pyasmjit/pyasmjit.c' ], ) setup( author = 'Christian Heitman', author_email = '[email protected]', description = 'PyAsmJIT', ext_modules = [ pyasmjit_module ], license = 'BSD 2-Clause', name = 'pyasmjit', version = '0.1', ) Update README. Add global change log file. Update version number.
#! /usr/bin/env python from setuptools import setup, Extension pyasmjit_module = Extension( 'pyasmjit.pyasmjit', sources = [ 'pyasmjit/pyasmjit.c' ], ) setup( author = 'Christian Heitman', author_email = '[email protected]', description = 'PyAsmJIT', ext_modules = [ pyasmjit_module ], license = 'BSD 2-Clause', name = 'pyasmjit', url = 'http://github.com/programa-stic/barf-project', version = '0.2', )
<commit_before>#! /usr/bin/env python from setuptools import setup, Extension pyasmjit_module = Extension( 'pyasmjit.pyasmjit', sources = [ 'pyasmjit/pyasmjit.c' ], ) setup( author = 'Christian Heitman', author_email = '[email protected]', description = 'PyAsmJIT', ext_modules = [ pyasmjit_module ], license = 'BSD 2-Clause', name = 'pyasmjit', version = '0.1', ) <commit_msg>Update README. Add global change log file. Update version number.<commit_after>
#! /usr/bin/env python from setuptools import setup, Extension pyasmjit_module = Extension( 'pyasmjit.pyasmjit', sources = [ 'pyasmjit/pyasmjit.c' ], ) setup( author = 'Christian Heitman', author_email = '[email protected]', description = 'PyAsmJIT', ext_modules = [ pyasmjit_module ], license = 'BSD 2-Clause', name = 'pyasmjit', url = 'http://github.com/programa-stic/barf-project', version = '0.2', )
#! /usr/bin/env python from setuptools import setup, Extension pyasmjit_module = Extension( 'pyasmjit.pyasmjit', sources = [ 'pyasmjit/pyasmjit.c' ], ) setup( author = 'Christian Heitman', author_email = '[email protected]', description = 'PyAsmJIT', ext_modules = [ pyasmjit_module ], license = 'BSD 2-Clause', name = 'pyasmjit', version = '0.1', ) Update README. Add global change log file. Update version number.#! /usr/bin/env python from setuptools import setup, Extension pyasmjit_module = Extension( 'pyasmjit.pyasmjit', sources = [ 'pyasmjit/pyasmjit.c' ], ) setup( author = 'Christian Heitman', author_email = '[email protected]', description = 'PyAsmJIT', ext_modules = [ pyasmjit_module ], license = 'BSD 2-Clause', name = 'pyasmjit', url = 'http://github.com/programa-stic/barf-project', version = '0.2', )
<commit_before>#! /usr/bin/env python from setuptools import setup, Extension pyasmjit_module = Extension( 'pyasmjit.pyasmjit', sources = [ 'pyasmjit/pyasmjit.c' ], ) setup( author = 'Christian Heitman', author_email = '[email protected]', description = 'PyAsmJIT', ext_modules = [ pyasmjit_module ], license = 'BSD 2-Clause', name = 'pyasmjit', version = '0.1', ) <commit_msg>Update README. Add global change log file. Update version number.<commit_after>#! /usr/bin/env python from setuptools import setup, Extension pyasmjit_module = Extension( 'pyasmjit.pyasmjit', sources = [ 'pyasmjit/pyasmjit.c' ], ) setup( author = 'Christian Heitman', author_email = '[email protected]', description = 'PyAsmJIT', ext_modules = [ pyasmjit_module ], license = 'BSD 2-Clause', name = 'pyasmjit', url = 'http://github.com/programa-stic/barf-project', version = '0.2', )
464b859aa48530190639077fe528d7d2be2961ce
setup.py
setup.py
#!/usr/bin/env python try: from setuptools import setup, find_packages except ImportError: from ez_setup import use_setuptools use_setuptools() from setuptools import setup, find_packages setup( name='Mooch Sentinel', version='0.0.1', description="Keep you from mooching unless chores are done", packages=find_packages(exclude=['ez_setup']), install_requires=[ 'flask', ], )
#!/usr/bin/env python try: from setuptools import setup, find_packages except ImportError: from ez_setup import use_setuptools use_setuptools() from setuptools import setup, find_packages setup( name='Mooch Sentinel', version='0.0.1', description="Keep you from mooching unless chores are done", packages=find_packages(exclude=['ez_setup']), install_requires=[ 'flask', 'requests', 'BeautifulSoup', ], )
Add dependencies on `requests` and `BeautifulSoup`
Add dependencies on `requests` and `BeautifulSoup`
Python
mit
asivokon/mooch-sentinel,asivokon/mooch-sentinel,asivokon/mooch-sentinel,asivokon/mooch-sentinel
#!/usr/bin/env python try: from setuptools import setup, find_packages except ImportError: from ez_setup import use_setuptools use_setuptools() from setuptools import setup, find_packages setup( name='Mooch Sentinel', version='0.0.1', description="Keep you from mooching unless chores are done", packages=find_packages(exclude=['ez_setup']), install_requires=[ 'flask', ], ) Add dependencies on `requests` and `BeautifulSoup`
#!/usr/bin/env python try: from setuptools import setup, find_packages except ImportError: from ez_setup import use_setuptools use_setuptools() from setuptools import setup, find_packages setup( name='Mooch Sentinel', version='0.0.1', description="Keep you from mooching unless chores are done", packages=find_packages(exclude=['ez_setup']), install_requires=[ 'flask', 'requests', 'BeautifulSoup', ], )
<commit_before>#!/usr/bin/env python try: from setuptools import setup, find_packages except ImportError: from ez_setup import use_setuptools use_setuptools() from setuptools import setup, find_packages setup( name='Mooch Sentinel', version='0.0.1', description="Keep you from mooching unless chores are done", packages=find_packages(exclude=['ez_setup']), install_requires=[ 'flask', ], ) <commit_msg>Add dependencies on `requests` and `BeautifulSoup`<commit_after>
#!/usr/bin/env python try: from setuptools import setup, find_packages except ImportError: from ez_setup import use_setuptools use_setuptools() from setuptools import setup, find_packages setup( name='Mooch Sentinel', version='0.0.1', description="Keep you from mooching unless chores are done", packages=find_packages(exclude=['ez_setup']), install_requires=[ 'flask', 'requests', 'BeautifulSoup', ], )
#!/usr/bin/env python try: from setuptools import setup, find_packages except ImportError: from ez_setup import use_setuptools use_setuptools() from setuptools import setup, find_packages setup( name='Mooch Sentinel', version='0.0.1', description="Keep you from mooching unless chores are done", packages=find_packages(exclude=['ez_setup']), install_requires=[ 'flask', ], ) Add dependencies on `requests` and `BeautifulSoup`#!/usr/bin/env python try: from setuptools import setup, find_packages except ImportError: from ez_setup import use_setuptools use_setuptools() from setuptools import setup, find_packages setup( name='Mooch Sentinel', version='0.0.1', description="Keep you from mooching unless chores are done", packages=find_packages(exclude=['ez_setup']), install_requires=[ 'flask', 'requests', 'BeautifulSoup', ], )
<commit_before>#!/usr/bin/env python try: from setuptools import setup, find_packages except ImportError: from ez_setup import use_setuptools use_setuptools() from setuptools import setup, find_packages setup( name='Mooch Sentinel', version='0.0.1', description="Keep you from mooching unless chores are done", packages=find_packages(exclude=['ez_setup']), install_requires=[ 'flask', ], ) <commit_msg>Add dependencies on `requests` and `BeautifulSoup`<commit_after>#!/usr/bin/env python try: from setuptools import setup, find_packages except ImportError: from ez_setup import use_setuptools use_setuptools() from setuptools import setup, find_packages setup( name='Mooch Sentinel', version='0.0.1', description="Keep you from mooching unless chores are done", packages=find_packages(exclude=['ez_setup']), install_requires=[ 'flask', 'requests', 'BeautifulSoup', ], )
bf5c3c0a9409115d4e743d9b53d3de2803937901
setup.py
setup.py
from setuptools import setup from setuptools.command.test import test as TestCommand import sys class Tox(TestCommand): user_options = [('tox-args=', 'a', "Arguments to pass to tox")] def initialize_options(self): TestCommand.initialize_options(self) self.tox_args = None def finalize_options(self): TestCommand.finalize_options(self) self.test_args = [] self.test_suite = True def run_tests(self): #import here, cause outside the eggs aren't loaded import tox import shlex errno = tox.cmdline(args=shlex.split(self.tox_args)) sys.exit(errno) setup( name = "adbpy", version = "0.0.2", url = "https://github.com/noahgoldman/adbpy", license = "MIT", author = "Noah Goldman", author_email = "[email protected]", description = "A library to communicate with ADB through it's " "internal socket interface, rather than the command" "line.", platforms = "any", packages = ["adbpy"], tests_require = ['tox'], cmdclass = {'test': Tox}, )
from setuptools import setup from setuptools.command.test import test as TestCommand import sys class Tox(TestCommand): user_options = [('tox-args=', 'a', "Arguments to pass to tox")] def initialize_options(self): TestCommand.initialize_options(self) self.tox_args = None def finalize_options(self): TestCommand.finalize_options(self) self.test_args = [] self.test_suite = True def run_tests(self): #import here, cause outside the eggs aren't loaded import tox import shlex errno = tox.cmdline(args=shlex.split(self.tox_args)) sys.exit(errno) setup( name = "adbpy", version = "0.0.3", url = "https://github.com/noahgoldman/adbpy", license = "MIT", author = "Noah Goldman", author_email = "[email protected]", description = "A library to communicate with ADB through it's " "internal socket interface, rather than the command" "line.", platforms = "any", packages = ["adbpy"], zip_safe = True, tests_require = ['tox'], cmdclass = {'test': Tox}, )
Allow package to be installed as an egg
Allow package to be installed as an egg
Python
mit
noahgoldman/adbpy
from setuptools import setup from setuptools.command.test import test as TestCommand import sys class Tox(TestCommand): user_options = [('tox-args=', 'a', "Arguments to pass to tox")] def initialize_options(self): TestCommand.initialize_options(self) self.tox_args = None def finalize_options(self): TestCommand.finalize_options(self) self.test_args = [] self.test_suite = True def run_tests(self): #import here, cause outside the eggs aren't loaded import tox import shlex errno = tox.cmdline(args=shlex.split(self.tox_args)) sys.exit(errno) setup( name = "adbpy", version = "0.0.2", url = "https://github.com/noahgoldman/adbpy", license = "MIT", author = "Noah Goldman", author_email = "[email protected]", description = "A library to communicate with ADB through it's " "internal socket interface, rather than the command" "line.", platforms = "any", packages = ["adbpy"], tests_require = ['tox'], cmdclass = {'test': Tox}, ) Allow package to be installed as an egg
from setuptools import setup from setuptools.command.test import test as TestCommand import sys class Tox(TestCommand): user_options = [('tox-args=', 'a', "Arguments to pass to tox")] def initialize_options(self): TestCommand.initialize_options(self) self.tox_args = None def finalize_options(self): TestCommand.finalize_options(self) self.test_args = [] self.test_suite = True def run_tests(self): #import here, cause outside the eggs aren't loaded import tox import shlex errno = tox.cmdline(args=shlex.split(self.tox_args)) sys.exit(errno) setup( name = "adbpy", version = "0.0.3", url = "https://github.com/noahgoldman/adbpy", license = "MIT", author = "Noah Goldman", author_email = "[email protected]", description = "A library to communicate with ADB through it's " "internal socket interface, rather than the command" "line.", platforms = "any", packages = ["adbpy"], zip_safe = True, tests_require = ['tox'], cmdclass = {'test': Tox}, )
<commit_before>from setuptools import setup from setuptools.command.test import test as TestCommand import sys class Tox(TestCommand): user_options = [('tox-args=', 'a', "Arguments to pass to tox")] def initialize_options(self): TestCommand.initialize_options(self) self.tox_args = None def finalize_options(self): TestCommand.finalize_options(self) self.test_args = [] self.test_suite = True def run_tests(self): #import here, cause outside the eggs aren't loaded import tox import shlex errno = tox.cmdline(args=shlex.split(self.tox_args)) sys.exit(errno) setup( name = "adbpy", version = "0.0.2", url = "https://github.com/noahgoldman/adbpy", license = "MIT", author = "Noah Goldman", author_email = "[email protected]", description = "A library to communicate with ADB through it's " "internal socket interface, rather than the command" "line.", platforms = "any", packages = ["adbpy"], tests_require = ['tox'], cmdclass = {'test': Tox}, ) <commit_msg>Allow package to be installed as an egg<commit_after>
from setuptools import setup from setuptools.command.test import test as TestCommand import sys class Tox(TestCommand): user_options = [('tox-args=', 'a', "Arguments to pass to tox")] def initialize_options(self): TestCommand.initialize_options(self) self.tox_args = None def finalize_options(self): TestCommand.finalize_options(self) self.test_args = [] self.test_suite = True def run_tests(self): #import here, cause outside the eggs aren't loaded import tox import shlex errno = tox.cmdline(args=shlex.split(self.tox_args)) sys.exit(errno) setup( name = "adbpy", version = "0.0.3", url = "https://github.com/noahgoldman/adbpy", license = "MIT", author = "Noah Goldman", author_email = "[email protected]", description = "A library to communicate with ADB through it's " "internal socket interface, rather than the command" "line.", platforms = "any", packages = ["adbpy"], zip_safe = True, tests_require = ['tox'], cmdclass = {'test': Tox}, )
from setuptools import setup from setuptools.command.test import test as TestCommand import sys class Tox(TestCommand): user_options = [('tox-args=', 'a', "Arguments to pass to tox")] def initialize_options(self): TestCommand.initialize_options(self) self.tox_args = None def finalize_options(self): TestCommand.finalize_options(self) self.test_args = [] self.test_suite = True def run_tests(self): #import here, cause outside the eggs aren't loaded import tox import shlex errno = tox.cmdline(args=shlex.split(self.tox_args)) sys.exit(errno) setup( name = "adbpy", version = "0.0.2", url = "https://github.com/noahgoldman/adbpy", license = "MIT", author = "Noah Goldman", author_email = "[email protected]", description = "A library to communicate with ADB through it's " "internal socket interface, rather than the command" "line.", platforms = "any", packages = ["adbpy"], tests_require = ['tox'], cmdclass = {'test': Tox}, ) Allow package to be installed as an eggfrom setuptools import setup from setuptools.command.test import test as TestCommand import sys class Tox(TestCommand): user_options = [('tox-args=', 'a', "Arguments to pass to tox")] def initialize_options(self): TestCommand.initialize_options(self) self.tox_args = None def finalize_options(self): TestCommand.finalize_options(self) self.test_args = [] self.test_suite = True def run_tests(self): #import here, cause outside the eggs aren't loaded import tox import shlex errno = tox.cmdline(args=shlex.split(self.tox_args)) sys.exit(errno) setup( name = "adbpy", version = "0.0.3", url = "https://github.com/noahgoldman/adbpy", license = "MIT", author = "Noah Goldman", author_email = "[email protected]", description = "A library to communicate with ADB through it's " "internal socket interface, rather than the command" "line.", platforms = "any", packages = ["adbpy"], zip_safe = True, tests_require = ['tox'], cmdclass = {'test': Tox}, )
<commit_before>from setuptools import setup from setuptools.command.test import test as TestCommand import sys class Tox(TestCommand): user_options = [('tox-args=', 'a', "Arguments to pass to tox")] def initialize_options(self): TestCommand.initialize_options(self) self.tox_args = None def finalize_options(self): TestCommand.finalize_options(self) self.test_args = [] self.test_suite = True def run_tests(self): #import here, cause outside the eggs aren't loaded import tox import shlex errno = tox.cmdline(args=shlex.split(self.tox_args)) sys.exit(errno) setup( name = "adbpy", version = "0.0.2", url = "https://github.com/noahgoldman/adbpy", license = "MIT", author = "Noah Goldman", author_email = "[email protected]", description = "A library to communicate with ADB through it's " "internal socket interface, rather than the command" "line.", platforms = "any", packages = ["adbpy"], tests_require = ['tox'], cmdclass = {'test': Tox}, ) <commit_msg>Allow package to be installed as an egg<commit_after>from setuptools import setup from setuptools.command.test import test as TestCommand import sys class Tox(TestCommand): user_options = [('tox-args=', 'a', "Arguments to pass to tox")] def initialize_options(self): TestCommand.initialize_options(self) self.tox_args = None def finalize_options(self): TestCommand.finalize_options(self) self.test_args = [] self.test_suite = True def run_tests(self): #import here, cause outside the eggs aren't loaded import tox import shlex errno = tox.cmdline(args=shlex.split(self.tox_args)) sys.exit(errno) setup( name = "adbpy", version = "0.0.3", url = "https://github.com/noahgoldman/adbpy", license = "MIT", author = "Noah Goldman", author_email = "[email protected]", description = "A library to communicate with ADB through it's " "internal socket interface, rather than the command" "line.", platforms = "any", packages = ["adbpy"], zip_safe = True, tests_require = ['tox'], cmdclass = {'test': Tox}, )
c23862a1c607eb0b9ee58f3826a958453426d097
setup.py
setup.py
#!/usr/bin/env python from setuptools import setup, find_packages setup( name="txyam2", version="0.5", description="Yet Another Memcached (YAM) client for Twisted.", author="Brian Muller", author_email="[email protected]", license="MIT", url="http://github.com/bmuller/txyam", packages=find_packages(), install_requires=[ 'twisted>=12.0', 'consistent_hash', ], )
#!/usr/bin/env python from setuptools import setup, find_packages setup( name="txyam2", version="0.5", description="Yet Another Memcached (YAM) client for Twisted.", author="Brian Muller", author_email="[email protected]", license="MIT", url="http://github.com/bmuller/txyam", packages=find_packages(), install_requires=[ 'twisted>=12.0', 'consistent_hash', ], extras_require={ 'sync': [ 'crochet>=1.2.0', ], }, )
Add extras for the sync client.
Add extras for the sync client.
Python
mit
Weasyl/txyam2
#!/usr/bin/env python from setuptools import setup, find_packages setup( name="txyam2", version="0.5", description="Yet Another Memcached (YAM) client for Twisted.", author="Brian Muller", author_email="[email protected]", license="MIT", url="http://github.com/bmuller/txyam", packages=find_packages(), install_requires=[ 'twisted>=12.0', 'consistent_hash', ], ) Add extras for the sync client.
#!/usr/bin/env python from setuptools import setup, find_packages setup( name="txyam2", version="0.5", description="Yet Another Memcached (YAM) client for Twisted.", author="Brian Muller", author_email="[email protected]", license="MIT", url="http://github.com/bmuller/txyam", packages=find_packages(), install_requires=[ 'twisted>=12.0', 'consistent_hash', ], extras_require={ 'sync': [ 'crochet>=1.2.0', ], }, )
<commit_before>#!/usr/bin/env python from setuptools import setup, find_packages setup( name="txyam2", version="0.5", description="Yet Another Memcached (YAM) client for Twisted.", author="Brian Muller", author_email="[email protected]", license="MIT", url="http://github.com/bmuller/txyam", packages=find_packages(), install_requires=[ 'twisted>=12.0', 'consistent_hash', ], ) <commit_msg>Add extras for the sync client.<commit_after>
#!/usr/bin/env python from setuptools import setup, find_packages setup( name="txyam2", version="0.5", description="Yet Another Memcached (YAM) client for Twisted.", author="Brian Muller", author_email="[email protected]", license="MIT", url="http://github.com/bmuller/txyam", packages=find_packages(), install_requires=[ 'twisted>=12.0', 'consistent_hash', ], extras_require={ 'sync': [ 'crochet>=1.2.0', ], }, )
#!/usr/bin/env python from setuptools import setup, find_packages setup( name="txyam2", version="0.5", description="Yet Another Memcached (YAM) client for Twisted.", author="Brian Muller", author_email="[email protected]", license="MIT", url="http://github.com/bmuller/txyam", packages=find_packages(), install_requires=[ 'twisted>=12.0', 'consistent_hash', ], ) Add extras for the sync client.#!/usr/bin/env python from setuptools import setup, find_packages setup( name="txyam2", version="0.5", description="Yet Another Memcached (YAM) client for Twisted.", author="Brian Muller", author_email="[email protected]", license="MIT", url="http://github.com/bmuller/txyam", packages=find_packages(), install_requires=[ 'twisted>=12.0', 'consistent_hash', ], extras_require={ 'sync': [ 'crochet>=1.2.0', ], }, )
<commit_before>#!/usr/bin/env python from setuptools import setup, find_packages setup( name="txyam2", version="0.5", description="Yet Another Memcached (YAM) client for Twisted.", author="Brian Muller", author_email="[email protected]", license="MIT", url="http://github.com/bmuller/txyam", packages=find_packages(), install_requires=[ 'twisted>=12.0', 'consistent_hash', ], ) <commit_msg>Add extras for the sync client.<commit_after>#!/usr/bin/env python from setuptools import setup, find_packages setup( name="txyam2", version="0.5", description="Yet Another Memcached (YAM) client for Twisted.", author="Brian Muller", author_email="[email protected]", license="MIT", url="http://github.com/bmuller/txyam", packages=find_packages(), install_requires=[ 'twisted>=12.0', 'consistent_hash', ], extras_require={ 'sync': [ 'crochet>=1.2.0', ], }, )
37cca32b8fd54d4b98a19c054c48964a5bcac40c
setup.py
setup.py
#!/usr/bin/env python from setuptools import setup, find_packages setup( name = "django-dummyimage", version = "0.1.1", description = "Dynamic Dummy Image Generator For Django!", author = "Rolando Espinoza La fuente", author_email = "[email protected]", url = "https://github.com/darkrho/django-dummyimage", license = "BSD", packages = find_packages(), zip_safe=False, # because we're including media that Django needs include_package_data = True, install_requires = [ 'Django', 'PIL', ], classifiers=[ 'Programming Language :: Python', 'Framework :: Django', 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', ], )
#!/usr/bin/env python from setuptools import setup, find_packages setup( name = "django-dummyimage", version = "0.1.1", description = "Dynamic Dummy Image Generator For Django!", author = "Rolando Espinoza La fuente", author_email = "[email protected]", url = "https://github.com/darkrho/django-dummyimage", license = "BSD", packages = find_packages(), zip_safe=False, # because we're including media that Django needs include_package_data = True, install_requires = [ 'Django', 'Pillow', ], classifiers=[ 'Programming Language :: Python', 'Framework :: Django', 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', ], )
Use Pillow instead of PIL
Use Pillow instead of PIL
Python
bsd-3-clause
trik/django-dummyimage,11craft/django-dummyimage
#!/usr/bin/env python from setuptools import setup, find_packages setup( name = "django-dummyimage", version = "0.1.1", description = "Dynamic Dummy Image Generator For Django!", author = "Rolando Espinoza La fuente", author_email = "[email protected]", url = "https://github.com/darkrho/django-dummyimage", license = "BSD", packages = find_packages(), zip_safe=False, # because we're including media that Django needs include_package_data = True, install_requires = [ 'Django', 'PIL', ], classifiers=[ 'Programming Language :: Python', 'Framework :: Django', 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', ], ) Use Pillow instead of PIL
#!/usr/bin/env python from setuptools import setup, find_packages setup( name = "django-dummyimage", version = "0.1.1", description = "Dynamic Dummy Image Generator For Django!", author = "Rolando Espinoza La fuente", author_email = "[email protected]", url = "https://github.com/darkrho/django-dummyimage", license = "BSD", packages = find_packages(), zip_safe=False, # because we're including media that Django needs include_package_data = True, install_requires = [ 'Django', 'Pillow', ], classifiers=[ 'Programming Language :: Python', 'Framework :: Django', 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', ], )
<commit_before>#!/usr/bin/env python from setuptools import setup, find_packages setup( name = "django-dummyimage", version = "0.1.1", description = "Dynamic Dummy Image Generator For Django!", author = "Rolando Espinoza La fuente", author_email = "[email protected]", url = "https://github.com/darkrho/django-dummyimage", license = "BSD", packages = find_packages(), zip_safe=False, # because we're including media that Django needs include_package_data = True, install_requires = [ 'Django', 'PIL', ], classifiers=[ 'Programming Language :: Python', 'Framework :: Django', 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', ], ) <commit_msg>Use Pillow instead of PIL<commit_after>
#!/usr/bin/env python from setuptools import setup, find_packages setup( name = "django-dummyimage", version = "0.1.1", description = "Dynamic Dummy Image Generator For Django!", author = "Rolando Espinoza La fuente", author_email = "[email protected]", url = "https://github.com/darkrho/django-dummyimage", license = "BSD", packages = find_packages(), zip_safe=False, # because we're including media that Django needs include_package_data = True, install_requires = [ 'Django', 'Pillow', ], classifiers=[ 'Programming Language :: Python', 'Framework :: Django', 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', ], )
#!/usr/bin/env python from setuptools import setup, find_packages setup( name = "django-dummyimage", version = "0.1.1", description = "Dynamic Dummy Image Generator For Django!", author = "Rolando Espinoza La fuente", author_email = "[email protected]", url = "https://github.com/darkrho/django-dummyimage", license = "BSD", packages = find_packages(), zip_safe=False, # because we're including media that Django needs include_package_data = True, install_requires = [ 'Django', 'PIL', ], classifiers=[ 'Programming Language :: Python', 'Framework :: Django', 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', ], ) Use Pillow instead of PIL#!/usr/bin/env python from setuptools import setup, find_packages setup( name = "django-dummyimage", version = "0.1.1", description = "Dynamic Dummy Image Generator For Django!", author = "Rolando Espinoza La fuente", author_email = "[email protected]", url = "https://github.com/darkrho/django-dummyimage", license = "BSD", packages = find_packages(), zip_safe=False, # because we're including media that Django needs include_package_data = True, install_requires = [ 'Django', 'Pillow', ], classifiers=[ 'Programming Language :: Python', 'Framework :: Django', 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', ], )
<commit_before>#!/usr/bin/env python from setuptools import setup, find_packages setup( name = "django-dummyimage", version = "0.1.1", description = "Dynamic Dummy Image Generator For Django!", author = "Rolando Espinoza La fuente", author_email = "[email protected]", url = "https://github.com/darkrho/django-dummyimage", license = "BSD", packages = find_packages(), zip_safe=False, # because we're including media that Django needs include_package_data = True, install_requires = [ 'Django', 'PIL', ], classifiers=[ 'Programming Language :: Python', 'Framework :: Django', 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', ], ) <commit_msg>Use Pillow instead of PIL<commit_after>#!/usr/bin/env python from setuptools import setup, find_packages setup( name = "django-dummyimage", version = "0.1.1", description = "Dynamic Dummy Image Generator For Django!", author = "Rolando Espinoza La fuente", author_email = "[email protected]", url = "https://github.com/darkrho/django-dummyimage", license = "BSD", packages = find_packages(), zip_safe=False, # because we're including media that Django needs include_package_data = True, install_requires = [ 'Django', 'Pillow', ], classifiers=[ 'Programming Language :: Python', 'Framework :: Django', 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', ], )
2202ecfafb085dbbaa1e2db1423b9d6f98f5f471
stack.py
stack.py
class StackItem(object): def __init__(self, data, next_item=None): self.data = data self.next_item = next_item def __str__(self): return self.data class StackFrame(object): def __init__(self, first_item=None): self.first_item = first_item def push(self, new_item): # push new_item to beginning of list if not self.first_item: self.first_item = new_item else: new_item.next_item = self.first_item self.first_item = new_item def pop(self): # poops first value from list and returns it obsolete_item = self.first_item self.first_item = self.first_item.next_item return obsolete_item.data
class StackItem(object): def __init__(self, data, next_item=None): self.data = data self.next_item = next_item def __str__(self): return self.data class StackFrame(object): def __init__(self, first_item=None): self.first_item = first_item def push(self, new_item): # push new_item to beginning of list if not self.first_item: self.first_item = new_item else: new_item.next_item = self.first_item self.first_item = new_item def pop(self): # poops first value from list and returns it if self.first_item is None: return ValueError("No items in stack!") else: obsolete_item = self.first_item self.first_item = self.first_item.next_item return obsolete_item.data
Fix pop to raise ValueError when empty Stack is popped
Fix pop to raise ValueError when empty Stack is popped
Python
mit
jwarren116/data-structures
class StackItem(object): def __init__(self, data, next_item=None): self.data = data self.next_item = next_item def __str__(self): return self.data class StackFrame(object): def __init__(self, first_item=None): self.first_item = first_item def push(self, new_item): # push new_item to beginning of list if not self.first_item: self.first_item = new_item else: new_item.next_item = self.first_item self.first_item = new_item def pop(self): # poops first value from list and returns it obsolete_item = self.first_item self.first_item = self.first_item.next_item return obsolete_item.data Fix pop to raise ValueError when empty Stack is popped
class StackItem(object): def __init__(self, data, next_item=None): self.data = data self.next_item = next_item def __str__(self): return self.data class StackFrame(object): def __init__(self, first_item=None): self.first_item = first_item def push(self, new_item): # push new_item to beginning of list if not self.first_item: self.first_item = new_item else: new_item.next_item = self.first_item self.first_item = new_item def pop(self): # poops first value from list and returns it if self.first_item is None: return ValueError("No items in stack!") else: obsolete_item = self.first_item self.first_item = self.first_item.next_item return obsolete_item.data
<commit_before>class StackItem(object): def __init__(self, data, next_item=None): self.data = data self.next_item = next_item def __str__(self): return self.data class StackFrame(object): def __init__(self, first_item=None): self.first_item = first_item def push(self, new_item): # push new_item to beginning of list if not self.first_item: self.first_item = new_item else: new_item.next_item = self.first_item self.first_item = new_item def pop(self): # poops first value from list and returns it obsolete_item = self.first_item self.first_item = self.first_item.next_item return obsolete_item.data <commit_msg>Fix pop to raise ValueError when empty Stack is popped<commit_after>
class StackItem(object): def __init__(self, data, next_item=None): self.data = data self.next_item = next_item def __str__(self): return self.data class StackFrame(object): def __init__(self, first_item=None): self.first_item = first_item def push(self, new_item): # push new_item to beginning of list if not self.first_item: self.first_item = new_item else: new_item.next_item = self.first_item self.first_item = new_item def pop(self): # poops first value from list and returns it if self.first_item is None: return ValueError("No items in stack!") else: obsolete_item = self.first_item self.first_item = self.first_item.next_item return obsolete_item.data
class StackItem(object): def __init__(self, data, next_item=None): self.data = data self.next_item = next_item def __str__(self): return self.data class StackFrame(object): def __init__(self, first_item=None): self.first_item = first_item def push(self, new_item): # push new_item to beginning of list if not self.first_item: self.first_item = new_item else: new_item.next_item = self.first_item self.first_item = new_item def pop(self): # poops first value from list and returns it obsolete_item = self.first_item self.first_item = self.first_item.next_item return obsolete_item.data Fix pop to raise ValueError when empty Stack is poppedclass StackItem(object): def __init__(self, data, next_item=None): self.data = data self.next_item = next_item def __str__(self): return self.data class StackFrame(object): def __init__(self, first_item=None): self.first_item = first_item def push(self, new_item): # push new_item to beginning of list if not self.first_item: self.first_item = new_item else: new_item.next_item = self.first_item self.first_item = new_item def pop(self): # poops first value from list and returns it if self.first_item is None: return ValueError("No items in stack!") else: obsolete_item = self.first_item self.first_item = self.first_item.next_item return obsolete_item.data
<commit_before>class StackItem(object): def __init__(self, data, next_item=None): self.data = data self.next_item = next_item def __str__(self): return self.data class StackFrame(object): def __init__(self, first_item=None): self.first_item = first_item def push(self, new_item): # push new_item to beginning of list if not self.first_item: self.first_item = new_item else: new_item.next_item = self.first_item self.first_item = new_item def pop(self): # poops first value from list and returns it obsolete_item = self.first_item self.first_item = self.first_item.next_item return obsolete_item.data <commit_msg>Fix pop to raise ValueError when empty Stack is popped<commit_after>class StackItem(object): def __init__(self, data, next_item=None): self.data = data self.next_item = next_item def __str__(self): return self.data class StackFrame(object): def __init__(self, first_item=None): self.first_item = first_item def push(self, new_item): # push new_item to beginning of list if not self.first_item: self.first_item = new_item else: new_item.next_item = self.first_item self.first_item = new_item def pop(self): # poops first value from list and returns it if self.first_item is None: return ValueError("No items in stack!") else: obsolete_item = self.first_item self.first_item = self.first_item.next_item return obsolete_item.data
fd6572b9910e0c5a01cbe1376f15059d80cf5093
all/templates/init.py
all/templates/init.py
from flask import Flask, url_for import os <%= appName %> = Flask(__name__) # Determines the destination of the build. Only usefull if you're using Frozen-Flask <%= appName %>.config['FREEZER_DESTINATION'] = os.path.dirname(os.path.abspath(__file__))+'/../build' # Function to easily find your assets # In your template use <link rel=stylesheet href="{{ static('filename') }}"> app.jinja_env.globals['static'] = ( lambda filename: url_for('static', filename = filename) ) from <%= appName %> import views
from flask import Flask, url_for import os <%= appName %> = Flask(__name__) # Determines the destination of the build. Only usefull if you're using Frozen-Flask <%= appName %>.config['FREEZER_DESTINATION'] = os.path.dirname(os.path.abspath(__file__))+'/../build' # Function to easily find your assets # In your template use <link rel=stylesheet href="{{ static('filename') }}"> <%= appName %>.jinja_env.globals['static'] = ( lambda filename: url_for('static', filename = filename) ) from <%= appName %> import views
Replace hardcoded "app" with parameter "appName"
Replace hardcoded "app" with parameter "appName"
Python
mit
romainberger/yeoman-flask,romainberger/yeoman-flask
from flask import Flask, url_for import os <%= appName %> = Flask(__name__) # Determines the destination of the build. Only usefull if you're using Frozen-Flask <%= appName %>.config['FREEZER_DESTINATION'] = os.path.dirname(os.path.abspath(__file__))+'/../build' # Function to easily find your assets # In your template use <link rel=stylesheet href="{{ static('filename') }}"> app.jinja_env.globals['static'] = ( lambda filename: url_for('static', filename = filename) ) from <%= appName %> import views Replace hardcoded "app" with parameter "appName"
from flask import Flask, url_for import os <%= appName %> = Flask(__name__) # Determines the destination of the build. Only usefull if you're using Frozen-Flask <%= appName %>.config['FREEZER_DESTINATION'] = os.path.dirname(os.path.abspath(__file__))+'/../build' # Function to easily find your assets # In your template use <link rel=stylesheet href="{{ static('filename') }}"> <%= appName %>.jinja_env.globals['static'] = ( lambda filename: url_for('static', filename = filename) ) from <%= appName %> import views
<commit_before>from flask import Flask, url_for import os <%= appName %> = Flask(__name__) # Determines the destination of the build. Only usefull if you're using Frozen-Flask <%= appName %>.config['FREEZER_DESTINATION'] = os.path.dirname(os.path.abspath(__file__))+'/../build' # Function to easily find your assets # In your template use <link rel=stylesheet href="{{ static('filename') }}"> app.jinja_env.globals['static'] = ( lambda filename: url_for('static', filename = filename) ) from <%= appName %> import views <commit_msg>Replace hardcoded "app" with parameter "appName"<commit_after>
from flask import Flask, url_for import os <%= appName %> = Flask(__name__) # Determines the destination of the build. Only usefull if you're using Frozen-Flask <%= appName %>.config['FREEZER_DESTINATION'] = os.path.dirname(os.path.abspath(__file__))+'/../build' # Function to easily find your assets # In your template use <link rel=stylesheet href="{{ static('filename') }}"> <%= appName %>.jinja_env.globals['static'] = ( lambda filename: url_for('static', filename = filename) ) from <%= appName %> import views
from flask import Flask, url_for import os <%= appName %> = Flask(__name__) # Determines the destination of the build. Only usefull if you're using Frozen-Flask <%= appName %>.config['FREEZER_DESTINATION'] = os.path.dirname(os.path.abspath(__file__))+'/../build' # Function to easily find your assets # In your template use <link rel=stylesheet href="{{ static('filename') }}"> app.jinja_env.globals['static'] = ( lambda filename: url_for('static', filename = filename) ) from <%= appName %> import views Replace hardcoded "app" with parameter "appName"from flask import Flask, url_for import os <%= appName %> = Flask(__name__) # Determines the destination of the build. Only usefull if you're using Frozen-Flask <%= appName %>.config['FREEZER_DESTINATION'] = os.path.dirname(os.path.abspath(__file__))+'/../build' # Function to easily find your assets # In your template use <link rel=stylesheet href="{{ static('filename') }}"> <%= appName %>.jinja_env.globals['static'] = ( lambda filename: url_for('static', filename = filename) ) from <%= appName %> import views
<commit_before>from flask import Flask, url_for import os <%= appName %> = Flask(__name__) # Determines the destination of the build. Only usefull if you're using Frozen-Flask <%= appName %>.config['FREEZER_DESTINATION'] = os.path.dirname(os.path.abspath(__file__))+'/../build' # Function to easily find your assets # In your template use <link rel=stylesheet href="{{ static('filename') }}"> app.jinja_env.globals['static'] = ( lambda filename: url_for('static', filename = filename) ) from <%= appName %> import views <commit_msg>Replace hardcoded "app" with parameter "appName"<commit_after>from flask import Flask, url_for import os <%= appName %> = Flask(__name__) # Determines the destination of the build. Only usefull if you're using Frozen-Flask <%= appName %>.config['FREEZER_DESTINATION'] = os.path.dirname(os.path.abspath(__file__))+'/../build' # Function to easily find your assets # In your template use <link rel=stylesheet href="{{ static('filename') }}"> <%= appName %>.jinja_env.globals['static'] = ( lambda filename: url_for('static', filename = filename) ) from <%= appName %> import views
47d950b882c01820db7fe99431526487d88622db
tasks.py
tasks.py
import os from invocations.docs import docs, www, sites, watch_docs from invocations.testing import test, coverage, integration, watch_tests from invocations.packaging import vendorize, release from invoke import Collection from invoke.util import LOG_FORMAT ns = Collection( test, coverage, integration, vendorize, release, www, docs, sites, watch_docs, watch_tests ) ns.configure({ 'tests': { 'logformat': LOG_FORMAT, 'package': 'invoke', }, 'packaging': { 'sign': True, 'wheel': True, # Because of PyYAML's dual source nonsense =/ 'dual_wheels': True, 'changelog_file': os.path.join( www.configuration()['sphinx']['source'], 'changelog.rst', ), }, })
import os from invocations.docs import docs, www, sites, watch_docs from invocations.testing import test, coverage, integration, watch_tests from invocations.packaging import vendorize, release from invoke import Collection from invoke.util import LOG_FORMAT ns = Collection( test, coverage, integration, vendorize, release, www, docs, sites, watch_docs, watch_tests ) ns.configure({ 'tests': { 'logformat': LOG_FORMAT, 'package': 'invoke', }, 'packaging': { 'sign': True, 'wheel': True, 'check_desc': True, # Because of PyYAML's dual source nonsense =/ 'dual_wheels': True, 'changelog_file': os.path.join( www.configuration()['sphinx']['source'], 'changelog.rst', ), }, })
Check setup.py desc when packaging
Check setup.py desc when packaging
Python
bsd-2-clause
pyinvoke/invoke,pyinvoke/invoke,mkusz/invoke,mkusz/invoke
import os from invocations.docs import docs, www, sites, watch_docs from invocations.testing import test, coverage, integration, watch_tests from invocations.packaging import vendorize, release from invoke import Collection from invoke.util import LOG_FORMAT ns = Collection( test, coverage, integration, vendorize, release, www, docs, sites, watch_docs, watch_tests ) ns.configure({ 'tests': { 'logformat': LOG_FORMAT, 'package': 'invoke', }, 'packaging': { 'sign': True, 'wheel': True, # Because of PyYAML's dual source nonsense =/ 'dual_wheels': True, 'changelog_file': os.path.join( www.configuration()['sphinx']['source'], 'changelog.rst', ), }, }) Check setup.py desc when packaging
import os from invocations.docs import docs, www, sites, watch_docs from invocations.testing import test, coverage, integration, watch_tests from invocations.packaging import vendorize, release from invoke import Collection from invoke.util import LOG_FORMAT ns = Collection( test, coverage, integration, vendorize, release, www, docs, sites, watch_docs, watch_tests ) ns.configure({ 'tests': { 'logformat': LOG_FORMAT, 'package': 'invoke', }, 'packaging': { 'sign': True, 'wheel': True, 'check_desc': True, # Because of PyYAML's dual source nonsense =/ 'dual_wheels': True, 'changelog_file': os.path.join( www.configuration()['sphinx']['source'], 'changelog.rst', ), }, })
<commit_before>import os from invocations.docs import docs, www, sites, watch_docs from invocations.testing import test, coverage, integration, watch_tests from invocations.packaging import vendorize, release from invoke import Collection from invoke.util import LOG_FORMAT ns = Collection( test, coverage, integration, vendorize, release, www, docs, sites, watch_docs, watch_tests ) ns.configure({ 'tests': { 'logformat': LOG_FORMAT, 'package': 'invoke', }, 'packaging': { 'sign': True, 'wheel': True, # Because of PyYAML's dual source nonsense =/ 'dual_wheels': True, 'changelog_file': os.path.join( www.configuration()['sphinx']['source'], 'changelog.rst', ), }, }) <commit_msg>Check setup.py desc when packaging<commit_after>
import os from invocations.docs import docs, www, sites, watch_docs from invocations.testing import test, coverage, integration, watch_tests from invocations.packaging import vendorize, release from invoke import Collection from invoke.util import LOG_FORMAT ns = Collection( test, coverage, integration, vendorize, release, www, docs, sites, watch_docs, watch_tests ) ns.configure({ 'tests': { 'logformat': LOG_FORMAT, 'package': 'invoke', }, 'packaging': { 'sign': True, 'wheel': True, 'check_desc': True, # Because of PyYAML's dual source nonsense =/ 'dual_wheels': True, 'changelog_file': os.path.join( www.configuration()['sphinx']['source'], 'changelog.rst', ), }, })
import os from invocations.docs import docs, www, sites, watch_docs from invocations.testing import test, coverage, integration, watch_tests from invocations.packaging import vendorize, release from invoke import Collection from invoke.util import LOG_FORMAT ns = Collection( test, coverage, integration, vendorize, release, www, docs, sites, watch_docs, watch_tests ) ns.configure({ 'tests': { 'logformat': LOG_FORMAT, 'package': 'invoke', }, 'packaging': { 'sign': True, 'wheel': True, # Because of PyYAML's dual source nonsense =/ 'dual_wheels': True, 'changelog_file': os.path.join( www.configuration()['sphinx']['source'], 'changelog.rst', ), }, }) Check setup.py desc when packagingimport os from invocations.docs import docs, www, sites, watch_docs from invocations.testing import test, coverage, integration, watch_tests from invocations.packaging import vendorize, release from invoke import Collection from invoke.util import LOG_FORMAT ns = Collection( test, coverage, integration, vendorize, release, www, docs, sites, watch_docs, watch_tests ) ns.configure({ 'tests': { 'logformat': LOG_FORMAT, 'package': 'invoke', }, 'packaging': { 'sign': True, 'wheel': True, 'check_desc': True, # Because of PyYAML's dual source nonsense =/ 'dual_wheels': True, 'changelog_file': os.path.join( www.configuration()['sphinx']['source'], 'changelog.rst', ), }, })
<commit_before>import os from invocations.docs import docs, www, sites, watch_docs from invocations.testing import test, coverage, integration, watch_tests from invocations.packaging import vendorize, release from invoke import Collection from invoke.util import LOG_FORMAT ns = Collection( test, coverage, integration, vendorize, release, www, docs, sites, watch_docs, watch_tests ) ns.configure({ 'tests': { 'logformat': LOG_FORMAT, 'package': 'invoke', }, 'packaging': { 'sign': True, 'wheel': True, # Because of PyYAML's dual source nonsense =/ 'dual_wheels': True, 'changelog_file': os.path.join( www.configuration()['sphinx']['source'], 'changelog.rst', ), }, }) <commit_msg>Check setup.py desc when packaging<commit_after>import os from invocations.docs import docs, www, sites, watch_docs from invocations.testing import test, coverage, integration, watch_tests from invocations.packaging import vendorize, release from invoke import Collection from invoke.util import LOG_FORMAT ns = Collection( test, coverage, integration, vendorize, release, www, docs, sites, watch_docs, watch_tests ) ns.configure({ 'tests': { 'logformat': LOG_FORMAT, 'package': 'invoke', }, 'packaging': { 'sign': True, 'wheel': True, 'check_desc': True, # Because of PyYAML's dual source nonsense =/ 'dual_wheels': True, 'changelog_file': os.path.join( www.configuration()['sphinx']['source'], 'changelog.rst', ), }, })
30709e0a8f5392260543b9d0fb168a3246d827ad
tasks.py
tasks.py
import invoke # Based on https://github.com/pyca/cryptography/blob/master/tasks.py @invoke.task def release(version): invoke.run("git tag -a release-{0} -m \"Tagged {0} release\"".format(version)) invoke.run("git push --tags") invoke.run("python setup.py sdist") invoke.run("twine upload dist/pyuv-{0}*".format(version))
import invoke # Based on https://github.com/pyca/cryptography/blob/master/tasks.py @invoke.task def release(version): invoke.run("git tag -a pyuv-{0} -m \"pyuv {0} release\"".format(version)) invoke.run("git push --tags") invoke.run("python setup.py sdist") invoke.run("twine upload dist/pyuv-{0}*".format(version))
Fix tag names so GitHub generates better filenames
Fix tag names so GitHub generates better filenames
Python
mit
saghul/pyuv,fivejjs/pyuv,fivejjs/pyuv,fivejjs/pyuv,saghul/pyuv,saghul/pyuv
import invoke # Based on https://github.com/pyca/cryptography/blob/master/tasks.py @invoke.task def release(version): invoke.run("git tag -a release-{0} -m \"Tagged {0} release\"".format(version)) invoke.run("git push --tags") invoke.run("python setup.py sdist") invoke.run("twine upload dist/pyuv-{0}*".format(version)) Fix tag names so GitHub generates better filenames
import invoke # Based on https://github.com/pyca/cryptography/blob/master/tasks.py @invoke.task def release(version): invoke.run("git tag -a pyuv-{0} -m \"pyuv {0} release\"".format(version)) invoke.run("git push --tags") invoke.run("python setup.py sdist") invoke.run("twine upload dist/pyuv-{0}*".format(version))
<commit_before> import invoke # Based on https://github.com/pyca/cryptography/blob/master/tasks.py @invoke.task def release(version): invoke.run("git tag -a release-{0} -m \"Tagged {0} release\"".format(version)) invoke.run("git push --tags") invoke.run("python setup.py sdist") invoke.run("twine upload dist/pyuv-{0}*".format(version)) <commit_msg>Fix tag names so GitHub generates better filenames<commit_after>
import invoke # Based on https://github.com/pyca/cryptography/blob/master/tasks.py @invoke.task def release(version): invoke.run("git tag -a pyuv-{0} -m \"pyuv {0} release\"".format(version)) invoke.run("git push --tags") invoke.run("python setup.py sdist") invoke.run("twine upload dist/pyuv-{0}*".format(version))
import invoke # Based on https://github.com/pyca/cryptography/blob/master/tasks.py @invoke.task def release(version): invoke.run("git tag -a release-{0} -m \"Tagged {0} release\"".format(version)) invoke.run("git push --tags") invoke.run("python setup.py sdist") invoke.run("twine upload dist/pyuv-{0}*".format(version)) Fix tag names so GitHub generates better filenames import invoke # Based on https://github.com/pyca/cryptography/blob/master/tasks.py @invoke.task def release(version): invoke.run("git tag -a pyuv-{0} -m \"pyuv {0} release\"".format(version)) invoke.run("git push --tags") invoke.run("python setup.py sdist") invoke.run("twine upload dist/pyuv-{0}*".format(version))
<commit_before> import invoke # Based on https://github.com/pyca/cryptography/blob/master/tasks.py @invoke.task def release(version): invoke.run("git tag -a release-{0} -m \"Tagged {0} release\"".format(version)) invoke.run("git push --tags") invoke.run("python setup.py sdist") invoke.run("twine upload dist/pyuv-{0}*".format(version)) <commit_msg>Fix tag names so GitHub generates better filenames<commit_after> import invoke # Based on https://github.com/pyca/cryptography/blob/master/tasks.py @invoke.task def release(version): invoke.run("git tag -a pyuv-{0} -m \"pyuv {0} release\"".format(version)) invoke.run("git push --tags") invoke.run("python setup.py sdist") invoke.run("twine upload dist/pyuv-{0}*".format(version))
15e4efdaa843ac5428e46d7d1566e9ef5acfaf9c
tmaps/defaultconfig.py
tmaps/defaultconfig.py
import logging import datetime DEBUG = True # Override this key with a secret one SECRET_KEY = 'default_secret_key' HASHIDS_SALT = 'default_secret_salt' ## Authentication JWT_EXPIRATION_DELTA = datetime.timedelta(days=2) JWT_NOT_BEFORE_DELTA = datetime.timedelta(seconds=0) ## Database SQLALCHEMY_DATABASE_URI = None SQLALCHEMY_TRACK_MODIFICATIONS = True ## Logging LOG_FILE = 'tissuemaps.log' LOG_LEVEL = logging.INFO LOG_MAX_BYTES = 2048000 # 2048KB LOG_N_BACKUPS = 10 ## Other # This should be set to true in the production config when using NGINX USE_X_SENDFILE = False REDIS_URL = 'redis://localhost:6379'
import logging import datetime DEBUG = False # Override this key with a secret one SECRET_KEY = 'default_secret_key' HASHIDS_SALT = 'default_secret_salt' ## Authentication JWT_EXPIRATION_DELTA = datetime.timedelta(days=2) JWT_NOT_BEFORE_DELTA = datetime.timedelta(seconds=0) ## Database SQLALCHEMY_DATABASE_URI = None SQLALCHEMY_TRACK_MODIFICATIONS = True ## Logging LOG_FILE = 'tissuemaps.log' LOG_LEVEL = logging.INFO LOG_MAX_BYTES = 2048000 # 2048KB LOG_N_BACKUPS = 10 ## Other # This should be set to true in the production config when using NGINX USE_X_SENDFILE = False REDIS_URL = 'redis://localhost:6379'
Remove spark settings from default config file
Remove spark settings from default config file
Python
agpl-3.0
TissueMAPS/TmServer
import logging import datetime DEBUG = True # Override this key with a secret one SECRET_KEY = 'default_secret_key' HASHIDS_SALT = 'default_secret_salt' ## Authentication JWT_EXPIRATION_DELTA = datetime.timedelta(days=2) JWT_NOT_BEFORE_DELTA = datetime.timedelta(seconds=0) ## Database SQLALCHEMY_DATABASE_URI = None SQLALCHEMY_TRACK_MODIFICATIONS = True ## Logging LOG_FILE = 'tissuemaps.log' LOG_LEVEL = logging.INFO LOG_MAX_BYTES = 2048000 # 2048KB LOG_N_BACKUPS = 10 ## Other # This should be set to true in the production config when using NGINX USE_X_SENDFILE = False REDIS_URL = 'redis://localhost:6379' Remove spark settings from default config file
import logging import datetime DEBUG = False # Override this key with a secret one SECRET_KEY = 'default_secret_key' HASHIDS_SALT = 'default_secret_salt' ## Authentication JWT_EXPIRATION_DELTA = datetime.timedelta(days=2) JWT_NOT_BEFORE_DELTA = datetime.timedelta(seconds=0) ## Database SQLALCHEMY_DATABASE_URI = None SQLALCHEMY_TRACK_MODIFICATIONS = True ## Logging LOG_FILE = 'tissuemaps.log' LOG_LEVEL = logging.INFO LOG_MAX_BYTES = 2048000 # 2048KB LOG_N_BACKUPS = 10 ## Other # This should be set to true in the production config when using NGINX USE_X_SENDFILE = False REDIS_URL = 'redis://localhost:6379'
<commit_before>import logging import datetime DEBUG = True # Override this key with a secret one SECRET_KEY = 'default_secret_key' HASHIDS_SALT = 'default_secret_salt' ## Authentication JWT_EXPIRATION_DELTA = datetime.timedelta(days=2) JWT_NOT_BEFORE_DELTA = datetime.timedelta(seconds=0) ## Database SQLALCHEMY_DATABASE_URI = None SQLALCHEMY_TRACK_MODIFICATIONS = True ## Logging LOG_FILE = 'tissuemaps.log' LOG_LEVEL = logging.INFO LOG_MAX_BYTES = 2048000 # 2048KB LOG_N_BACKUPS = 10 ## Other # This should be set to true in the production config when using NGINX USE_X_SENDFILE = False REDIS_URL = 'redis://localhost:6379' <commit_msg>Remove spark settings from default config file<commit_after>
import logging import datetime DEBUG = False # Override this key with a secret one SECRET_KEY = 'default_secret_key' HASHIDS_SALT = 'default_secret_salt' ## Authentication JWT_EXPIRATION_DELTA = datetime.timedelta(days=2) JWT_NOT_BEFORE_DELTA = datetime.timedelta(seconds=0) ## Database SQLALCHEMY_DATABASE_URI = None SQLALCHEMY_TRACK_MODIFICATIONS = True ## Logging LOG_FILE = 'tissuemaps.log' LOG_LEVEL = logging.INFO LOG_MAX_BYTES = 2048000 # 2048KB LOG_N_BACKUPS = 10 ## Other # This should be set to true in the production config when using NGINX USE_X_SENDFILE = False REDIS_URL = 'redis://localhost:6379'
import logging import datetime DEBUG = True # Override this key with a secret one SECRET_KEY = 'default_secret_key' HASHIDS_SALT = 'default_secret_salt' ## Authentication JWT_EXPIRATION_DELTA = datetime.timedelta(days=2) JWT_NOT_BEFORE_DELTA = datetime.timedelta(seconds=0) ## Database SQLALCHEMY_DATABASE_URI = None SQLALCHEMY_TRACK_MODIFICATIONS = True ## Logging LOG_FILE = 'tissuemaps.log' LOG_LEVEL = logging.INFO LOG_MAX_BYTES = 2048000 # 2048KB LOG_N_BACKUPS = 10 ## Other # This should be set to true in the production config when using NGINX USE_X_SENDFILE = False REDIS_URL = 'redis://localhost:6379' Remove spark settings from default config fileimport logging import datetime DEBUG = False # Override this key with a secret one SECRET_KEY = 'default_secret_key' HASHIDS_SALT = 'default_secret_salt' ## Authentication JWT_EXPIRATION_DELTA = datetime.timedelta(days=2) JWT_NOT_BEFORE_DELTA = datetime.timedelta(seconds=0) ## Database SQLALCHEMY_DATABASE_URI = None SQLALCHEMY_TRACK_MODIFICATIONS = True ## Logging LOG_FILE = 'tissuemaps.log' LOG_LEVEL = logging.INFO LOG_MAX_BYTES = 2048000 # 2048KB LOG_N_BACKUPS = 10 ## Other # This should be set to true in the production config when using NGINX USE_X_SENDFILE = False REDIS_URL = 'redis://localhost:6379'
<commit_before>import logging import datetime DEBUG = True # Override this key with a secret one SECRET_KEY = 'default_secret_key' HASHIDS_SALT = 'default_secret_salt' ## Authentication JWT_EXPIRATION_DELTA = datetime.timedelta(days=2) JWT_NOT_BEFORE_DELTA = datetime.timedelta(seconds=0) ## Database SQLALCHEMY_DATABASE_URI = None SQLALCHEMY_TRACK_MODIFICATIONS = True ## Logging LOG_FILE = 'tissuemaps.log' LOG_LEVEL = logging.INFO LOG_MAX_BYTES = 2048000 # 2048KB LOG_N_BACKUPS = 10 ## Other # This should be set to true in the production config when using NGINX USE_X_SENDFILE = False REDIS_URL = 'redis://localhost:6379' <commit_msg>Remove spark settings from default config file<commit_after>import logging import datetime DEBUG = False # Override this key with a secret one SECRET_KEY = 'default_secret_key' HASHIDS_SALT = 'default_secret_salt' ## Authentication JWT_EXPIRATION_DELTA = datetime.timedelta(days=2) JWT_NOT_BEFORE_DELTA = datetime.timedelta(seconds=0) ## Database SQLALCHEMY_DATABASE_URI = None SQLALCHEMY_TRACK_MODIFICATIONS = True ## Logging LOG_FILE = 'tissuemaps.log' LOG_LEVEL = logging.INFO LOG_MAX_BYTES = 2048000 # 2048KB LOG_N_BACKUPS = 10 ## Other # This should be set to true in the production config when using NGINX USE_X_SENDFILE = False REDIS_URL = 'redis://localhost:6379'
fe033ea76c8dcc5a90b0ba28c2c851b4ebb3ed15
src/clients/lib/python/xmmsclient/propdict.py
src/clients/lib/python/xmmsclient/propdict.py
class PropDict(dict): def __init__(self, srcs): dict.__init__(self) self._sources = srcs def set_source_preference(self, sources): """ Change list of source preference This method has been deprecated and should no longer be used. """ raise DeprecationWarning("This method has been deprecated and should no longer be used. Set the sources list using the 'sources' property.") self._set_sources(sources) def has_key(self, item): try: self.__getitem__(item) return True except KeyError: return False def __contains__(self, item): return self.has_key(item) def __getitem__(self, item): if isinstance(item, basestring): for src in self._sources: if src.endswith('*'): for k,v in self.iteritems(): if k[0].startswith(src[:-1]) and k[1] == item: return v try: t = dict.__getitem__(self, (src, item)) return t except KeyError: pass raise KeyError, item return dict.__getitem__(self, item) def get(self, item, default=None): try: return self[item] except KeyError: return default def _get_sources(self): return self._sources def _set_sources(self, val): if not isinstance(val, list): raise TypeError("Need a list of sources") for i in val: if not isinstance(i, basestring): raise TypeError("Sources need to be strings") self._sources = val sources = property(_get_sources, _set_sources)
class PropDict(dict): def __init__(self, srcs): dict.__init__(self) self._sources = srcs def set_source_preference(self, sources): """ Change list of source preference This method has been deprecated and should no longer be used. """ raise DeprecationWarning("This method has been deprecated and should no longer be used. Set the sources list using the 'sources' property.") self._set_sources(sources) def has_key(self, item): try: self.__getitem__(item) return True except KeyError: return False def __contains__(self, item): return self.has_key(item) def __getitem__(self, item): if isinstance(item, basestring): for src in self._sources: if src.endswith('*'): for k,v in self.iteritems(): if k[0].startswith(src[:-1]) and k[1] == item: return v try: t = dict.__getitem__(self, (src, item)) return t except KeyError: pass raise KeyError, item return dict.__getitem__(self, item) def get(self, item, default=None): try: return self[item] except KeyError: return default def _get_sources(self): return self._sources def _set_sources(self, val): if isinstance(val, basestring): raise TypeError("Need a sequence of sources") for i in val: if not isinstance(i, basestring): raise TypeError("Sources need to be strings") self._sources = val sources = property(_get_sources, _set_sources)
Allow PropDict.sources in python bindings to be any sequence.
BUG(1900): Allow PropDict.sources in python bindings to be any sequence.
Python
lgpl-2.1
mantaraya36/xmms2-mantaraya36,theeternalsw0rd/xmms2,mantaraya36/xmms2-mantaraya36,dreamerc/xmms2,chrippa/xmms2,mantaraya36/xmms2-mantaraya36,krad-radio/xmms2-krad,krad-radio/xmms2-krad,chrippa/xmms2,oneman/xmms2-oneman-old,six600110/xmms2,krad-radio/xmms2-krad,six600110/xmms2,theeternalsw0rd/xmms2,chrippa/xmms2,oneman/xmms2-oneman,mantaraya36/xmms2-mantaraya36,theeternalsw0rd/xmms2,chrippa/xmms2,xmms2/xmms2-stable,oneman/xmms2-oneman-old,xmms2/xmms2-stable,six600110/xmms2,oneman/xmms2-oneman-old,six600110/xmms2,oneman/xmms2-oneman-old,oneman/xmms2-oneman,dreamerc/xmms2,dreamerc/xmms2,theefer/xmms2,theefer/xmms2,krad-radio/xmms2-krad,oneman/xmms2-oneman,chrippa/xmms2,theefer/xmms2,theefer/xmms2,theeternalsw0rd/xmms2,theefer/xmms2,mantaraya36/xmms2-mantaraya36,chrippa/xmms2,oneman/xmms2-oneman,oneman/xmms2-oneman-old,theefer/xmms2,oneman/xmms2-oneman,mantaraya36/xmms2-mantaraya36,xmms2/xmms2-stable,six600110/xmms2,dreamerc/xmms2,dreamerc/xmms2,theefer/xmms2,theeternalsw0rd/xmms2,mantaraya36/xmms2-mantaraya36,krad-radio/xmms2-krad,xmms2/xmms2-stable,oneman/xmms2-oneman,oneman/xmms2-oneman,xmms2/xmms2-stable,krad-radio/xmms2-krad,xmms2/xmms2-stable,theeternalsw0rd/xmms2,six600110/xmms2
class PropDict(dict): def __init__(self, srcs): dict.__init__(self) self._sources = srcs def set_source_preference(self, sources): """ Change list of source preference This method has been deprecated and should no longer be used. """ raise DeprecationWarning("This method has been deprecated and should no longer be used. Set the sources list using the 'sources' property.") self._set_sources(sources) def has_key(self, item): try: self.__getitem__(item) return True except KeyError: return False def __contains__(self, item): return self.has_key(item) def __getitem__(self, item): if isinstance(item, basestring): for src in self._sources: if src.endswith('*'): for k,v in self.iteritems(): if k[0].startswith(src[:-1]) and k[1] == item: return v try: t = dict.__getitem__(self, (src, item)) return t except KeyError: pass raise KeyError, item return dict.__getitem__(self, item) def get(self, item, default=None): try: return self[item] except KeyError: return default def _get_sources(self): return self._sources def _set_sources(self, val): if not isinstance(val, list): raise TypeError("Need a list of sources") for i in val: if not isinstance(i, basestring): raise TypeError("Sources need to be strings") self._sources = val sources = property(_get_sources, _set_sources) BUG(1900): Allow PropDict.sources in python bindings to be any sequence.
class PropDict(dict): def __init__(self, srcs): dict.__init__(self) self._sources = srcs def set_source_preference(self, sources): """ Change list of source preference This method has been deprecated and should no longer be used. """ raise DeprecationWarning("This method has been deprecated and should no longer be used. Set the sources list using the 'sources' property.") self._set_sources(sources) def has_key(self, item): try: self.__getitem__(item) return True except KeyError: return False def __contains__(self, item): return self.has_key(item) def __getitem__(self, item): if isinstance(item, basestring): for src in self._sources: if src.endswith('*'): for k,v in self.iteritems(): if k[0].startswith(src[:-1]) and k[1] == item: return v try: t = dict.__getitem__(self, (src, item)) return t except KeyError: pass raise KeyError, item return dict.__getitem__(self, item) def get(self, item, default=None): try: return self[item] except KeyError: return default def _get_sources(self): return self._sources def _set_sources(self, val): if isinstance(val, basestring): raise TypeError("Need a sequence of sources") for i in val: if not isinstance(i, basestring): raise TypeError("Sources need to be strings") self._sources = val sources = property(_get_sources, _set_sources)
<commit_before>class PropDict(dict): def __init__(self, srcs): dict.__init__(self) self._sources = srcs def set_source_preference(self, sources): """ Change list of source preference This method has been deprecated and should no longer be used. """ raise DeprecationWarning("This method has been deprecated and should no longer be used. Set the sources list using the 'sources' property.") self._set_sources(sources) def has_key(self, item): try: self.__getitem__(item) return True except KeyError: return False def __contains__(self, item): return self.has_key(item) def __getitem__(self, item): if isinstance(item, basestring): for src in self._sources: if src.endswith('*'): for k,v in self.iteritems(): if k[0].startswith(src[:-1]) and k[1] == item: return v try: t = dict.__getitem__(self, (src, item)) return t except KeyError: pass raise KeyError, item return dict.__getitem__(self, item) def get(self, item, default=None): try: return self[item] except KeyError: return default def _get_sources(self): return self._sources def _set_sources(self, val): if not isinstance(val, list): raise TypeError("Need a list of sources") for i in val: if not isinstance(i, basestring): raise TypeError("Sources need to be strings") self._sources = val sources = property(_get_sources, _set_sources) <commit_msg>BUG(1900): Allow PropDict.sources in python bindings to be any sequence.<commit_after>
class PropDict(dict): def __init__(self, srcs): dict.__init__(self) self._sources = srcs def set_source_preference(self, sources): """ Change list of source preference This method has been deprecated and should no longer be used. """ raise DeprecationWarning("This method has been deprecated and should no longer be used. Set the sources list using the 'sources' property.") self._set_sources(sources) def has_key(self, item): try: self.__getitem__(item) return True except KeyError: return False def __contains__(self, item): return self.has_key(item) def __getitem__(self, item): if isinstance(item, basestring): for src in self._sources: if src.endswith('*'): for k,v in self.iteritems(): if k[0].startswith(src[:-1]) and k[1] == item: return v try: t = dict.__getitem__(self, (src, item)) return t except KeyError: pass raise KeyError, item return dict.__getitem__(self, item) def get(self, item, default=None): try: return self[item] except KeyError: return default def _get_sources(self): return self._sources def _set_sources(self, val): if isinstance(val, basestring): raise TypeError("Need a sequence of sources") for i in val: if not isinstance(i, basestring): raise TypeError("Sources need to be strings") self._sources = val sources = property(_get_sources, _set_sources)
class PropDict(dict): def __init__(self, srcs): dict.__init__(self) self._sources = srcs def set_source_preference(self, sources): """ Change list of source preference This method has been deprecated and should no longer be used. """ raise DeprecationWarning("This method has been deprecated and should no longer be used. Set the sources list using the 'sources' property.") self._set_sources(sources) def has_key(self, item): try: self.__getitem__(item) return True except KeyError: return False def __contains__(self, item): return self.has_key(item) def __getitem__(self, item): if isinstance(item, basestring): for src in self._sources: if src.endswith('*'): for k,v in self.iteritems(): if k[0].startswith(src[:-1]) and k[1] == item: return v try: t = dict.__getitem__(self, (src, item)) return t except KeyError: pass raise KeyError, item return dict.__getitem__(self, item) def get(self, item, default=None): try: return self[item] except KeyError: return default def _get_sources(self): return self._sources def _set_sources(self, val): if not isinstance(val, list): raise TypeError("Need a list of sources") for i in val: if not isinstance(i, basestring): raise TypeError("Sources need to be strings") self._sources = val sources = property(_get_sources, _set_sources) BUG(1900): Allow PropDict.sources in python bindings to be any sequence.class PropDict(dict): def __init__(self, srcs): dict.__init__(self) self._sources = srcs def set_source_preference(self, sources): """ Change list of source preference This method has been deprecated and should no longer be used. """ raise DeprecationWarning("This method has been deprecated and should no longer be used. Set the sources list using the 'sources' property.") self._set_sources(sources) def has_key(self, item): try: self.__getitem__(item) return True except KeyError: return False def __contains__(self, item): return self.has_key(item) def __getitem__(self, item): if isinstance(item, basestring): for src in self._sources: if src.endswith('*'): for k,v in self.iteritems(): if k[0].startswith(src[:-1]) and k[1] == item: return v try: t = dict.__getitem__(self, (src, item)) return t except KeyError: pass raise KeyError, item return dict.__getitem__(self, item) def get(self, item, default=None): try: return self[item] except KeyError: return default def _get_sources(self): return self._sources def _set_sources(self, val): if isinstance(val, basestring): raise TypeError("Need a sequence of sources") for i in val: if not isinstance(i, basestring): raise TypeError("Sources need to be strings") self._sources = val sources = property(_get_sources, _set_sources)
<commit_before>class PropDict(dict): def __init__(self, srcs): dict.__init__(self) self._sources = srcs def set_source_preference(self, sources): """ Change list of source preference This method has been deprecated and should no longer be used. """ raise DeprecationWarning("This method has been deprecated and should no longer be used. Set the sources list using the 'sources' property.") self._set_sources(sources) def has_key(self, item): try: self.__getitem__(item) return True except KeyError: return False def __contains__(self, item): return self.has_key(item) def __getitem__(self, item): if isinstance(item, basestring): for src in self._sources: if src.endswith('*'): for k,v in self.iteritems(): if k[0].startswith(src[:-1]) and k[1] == item: return v try: t = dict.__getitem__(self, (src, item)) return t except KeyError: pass raise KeyError, item return dict.__getitem__(self, item) def get(self, item, default=None): try: return self[item] except KeyError: return default def _get_sources(self): return self._sources def _set_sources(self, val): if not isinstance(val, list): raise TypeError("Need a list of sources") for i in val: if not isinstance(i, basestring): raise TypeError("Sources need to be strings") self._sources = val sources = property(_get_sources, _set_sources) <commit_msg>BUG(1900): Allow PropDict.sources in python bindings to be any sequence.<commit_after>class PropDict(dict): def __init__(self, srcs): dict.__init__(self) self._sources = srcs def set_source_preference(self, sources): """ Change list of source preference This method has been deprecated and should no longer be used. """ raise DeprecationWarning("This method has been deprecated and should no longer be used. Set the sources list using the 'sources' property.") self._set_sources(sources) def has_key(self, item): try: self.__getitem__(item) return True except KeyError: return False def __contains__(self, item): return self.has_key(item) def __getitem__(self, item): if isinstance(item, basestring): for src in self._sources: if src.endswith('*'): for k,v in self.iteritems(): if k[0].startswith(src[:-1]) and k[1] == item: return v try: t = dict.__getitem__(self, (src, item)) return t except KeyError: pass raise KeyError, item return dict.__getitem__(self, item) def get(self, item, default=None): try: return self[item] except KeyError: return default def _get_sources(self): return self._sources def _set_sources(self, val): if isinstance(val, basestring): raise TypeError("Need a sequence of sources") for i in val: if not isinstance(i, basestring): raise TypeError("Sources need to be strings") self._sources = val sources = property(_get_sources, _set_sources)
f90d4f61a4474fcff19187f81769f29b123d5765
tomviz/python/setup.py
tomviz/python/setup.py
from setuptools import setup, find_packages setup( name='tomviz-external', version='0.0.1', description='Tomviz python external execution infrastructure.', author='Kitware, Inc.', author_email='[email protected]', url='https://www.tomviz.org/', license='BSD 3-Clause', classifiers=[ 'Development Status :: 3 - Alpha', 'License :: OSI Approved :: BSD 3-Clause', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.5' ], packages=find_packages(), install_requires=['tqdm', 'h5py', 'numpy', 'click'], entry_points={ 'console_scripts': [ 'tomviz-pipeline = tomviz.cli:main' ] } )
from setuptools import setup, find_packages setup( name='tomviz-external', version='0.0.1', description='Tomviz python external execution infrastructure.', author='Kitware, Inc.', author_email='[email protected]', url='https://www.tomviz.org/', license='BSD 3-Clause', classifiers=[ 'Development Status :: 3 - Alpha', 'License :: OSI Approved :: BSD 3-Clause', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.5' ], packages=find_packages(), install_requires=['tqdm', 'h5py', 'numpy', 'click', 'scipy'], entry_points={ 'console_scripts': [ 'tomviz-pipeline = tomviz.cli:main' ] } )
Add scipy as dependency for tomviz-pipeline
Add scipy as dependency for tomviz-pipeline
Python
bsd-3-clause
mathturtle/tomviz,mathturtle/tomviz,OpenChemistry/tomviz,OpenChemistry/tomviz,OpenChemistry/tomviz,mathturtle/tomviz,OpenChemistry/tomviz
from setuptools import setup, find_packages setup( name='tomviz-external', version='0.0.1', description='Tomviz python external execution infrastructure.', author='Kitware, Inc.', author_email='[email protected]', url='https://www.tomviz.org/', license='BSD 3-Clause', classifiers=[ 'Development Status :: 3 - Alpha', 'License :: OSI Approved :: BSD 3-Clause', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.5' ], packages=find_packages(), install_requires=['tqdm', 'h5py', 'numpy', 'click'], entry_points={ 'console_scripts': [ 'tomviz-pipeline = tomviz.cli:main' ] } ) Add scipy as dependency for tomviz-pipeline
from setuptools import setup, find_packages setup( name='tomviz-external', version='0.0.1', description='Tomviz python external execution infrastructure.', author='Kitware, Inc.', author_email='[email protected]', url='https://www.tomviz.org/', license='BSD 3-Clause', classifiers=[ 'Development Status :: 3 - Alpha', 'License :: OSI Approved :: BSD 3-Clause', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.5' ], packages=find_packages(), install_requires=['tqdm', 'h5py', 'numpy', 'click', 'scipy'], entry_points={ 'console_scripts': [ 'tomviz-pipeline = tomviz.cli:main' ] } )
<commit_before>from setuptools import setup, find_packages setup( name='tomviz-external', version='0.0.1', description='Tomviz python external execution infrastructure.', author='Kitware, Inc.', author_email='[email protected]', url='https://www.tomviz.org/', license='BSD 3-Clause', classifiers=[ 'Development Status :: 3 - Alpha', 'License :: OSI Approved :: BSD 3-Clause', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.5' ], packages=find_packages(), install_requires=['tqdm', 'h5py', 'numpy', 'click'], entry_points={ 'console_scripts': [ 'tomviz-pipeline = tomviz.cli:main' ] } ) <commit_msg>Add scipy as dependency for tomviz-pipeline<commit_after>
from setuptools import setup, find_packages setup( name='tomviz-external', version='0.0.1', description='Tomviz python external execution infrastructure.', author='Kitware, Inc.', author_email='[email protected]', url='https://www.tomviz.org/', license='BSD 3-Clause', classifiers=[ 'Development Status :: 3 - Alpha', 'License :: OSI Approved :: BSD 3-Clause', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.5' ], packages=find_packages(), install_requires=['tqdm', 'h5py', 'numpy', 'click', 'scipy'], entry_points={ 'console_scripts': [ 'tomviz-pipeline = tomviz.cli:main' ] } )
from setuptools import setup, find_packages setup( name='tomviz-external', version='0.0.1', description='Tomviz python external execution infrastructure.', author='Kitware, Inc.', author_email='[email protected]', url='https://www.tomviz.org/', license='BSD 3-Clause', classifiers=[ 'Development Status :: 3 - Alpha', 'License :: OSI Approved :: BSD 3-Clause', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.5' ], packages=find_packages(), install_requires=['tqdm', 'h5py', 'numpy', 'click'], entry_points={ 'console_scripts': [ 'tomviz-pipeline = tomviz.cli:main' ] } ) Add scipy as dependency for tomviz-pipelinefrom setuptools import setup, find_packages setup( name='tomviz-external', version='0.0.1', description='Tomviz python external execution infrastructure.', author='Kitware, Inc.', author_email='[email protected]', url='https://www.tomviz.org/', license='BSD 3-Clause', classifiers=[ 'Development Status :: 3 - Alpha', 'License :: OSI Approved :: BSD 3-Clause', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.5' ], packages=find_packages(), install_requires=['tqdm', 'h5py', 'numpy', 'click', 'scipy'], entry_points={ 'console_scripts': [ 'tomviz-pipeline = tomviz.cli:main' ] } )
<commit_before>from setuptools import setup, find_packages setup( name='tomviz-external', version='0.0.1', description='Tomviz python external execution infrastructure.', author='Kitware, Inc.', author_email='[email protected]', url='https://www.tomviz.org/', license='BSD 3-Clause', classifiers=[ 'Development Status :: 3 - Alpha', 'License :: OSI Approved :: BSD 3-Clause', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.5' ], packages=find_packages(), install_requires=['tqdm', 'h5py', 'numpy', 'click'], entry_points={ 'console_scripts': [ 'tomviz-pipeline = tomviz.cli:main' ] } ) <commit_msg>Add scipy as dependency for tomviz-pipeline<commit_after>from setuptools import setup, find_packages setup( name='tomviz-external', version='0.0.1', description='Tomviz python external execution infrastructure.', author='Kitware, Inc.', author_email='[email protected]', url='https://www.tomviz.org/', license='BSD 3-Clause', classifiers=[ 'Development Status :: 3 - Alpha', 'License :: OSI Approved :: BSD 3-Clause', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.5' ], packages=find_packages(), install_requires=['tqdm', 'h5py', 'numpy', 'click', 'scipy'], entry_points={ 'console_scripts': [ 'tomviz-pipeline = tomviz.cli:main' ] } )
fd660a62bd142d4ef36bde44a02b28146498bfc6
driver_code_test.py
driver_code_test.py
import SimpleCV as scv from SimpleCV import Image import cv2 import time from start_camera import start_camera import threading # camera_thread = threading.Thread(target=start_camera) # camera_thread.start() # from get_images_from_pi import get_image, valid_image # time.sleep(2) # count = 0 # while (count < 50): # get_image(count) # count += 1 # exit() image = Image('images/stop') image.show() image.show() time.sleep(2) reds = image.hueDistance(color=scv.Color.RED) reds.show() reds.show() time.sleep(2) stretch = reds.stretch(20,21) stretch.show() stretch.show() time.sleep(3) # blobs = image.findBlobs() # if blobs: # for blob in blobs: # print "got a blob" # blob.draw(color=(0, 128, 0)) # image.show() # image.show() # time.sleep(4)
import SimpleCV as scv from SimpleCV import Image import cv2 import time from start_camera import start_camera import threading def take_50_pictures(): camera_thread = threading.Thread(target=start_camera) camera_thread.start() from get_images_from_pi import get_image, valid_image time.sleep(2) count = 0 while (count < 50): get_image(count) count += 1 def detect_stop_sign(image): reds = image.hueDistance(color=scv.Color.RED) stretch = reds.stretch(20,21) invert = stretch.invert() blobs = invert.findBlobs(minsize=2000) if blobs: for blob in blobs: print blob.area() blob.draw(color=(0, 128, 0)) invert.show() invert.show() time.sleep(3) image = Image('images/0.jpg') x = 0 while (x < 40): image = Image('images/'+ str(x) + '.jpg') detect_stop_sign(image) print x x +=1 exit()
Add simple logic to driver code test for easy testing
Add simple logic to driver code test for easy testing
Python
mit
jwarshaw/RaspberryDrive
import SimpleCV as scv from SimpleCV import Image import cv2 import time from start_camera import start_camera import threading # camera_thread = threading.Thread(target=start_camera) # camera_thread.start() # from get_images_from_pi import get_image, valid_image # time.sleep(2) # count = 0 # while (count < 50): # get_image(count) # count += 1 # exit() image = Image('images/stop') image.show() image.show() time.sleep(2) reds = image.hueDistance(color=scv.Color.RED) reds.show() reds.show() time.sleep(2) stretch = reds.stretch(20,21) stretch.show() stretch.show() time.sleep(3) # blobs = image.findBlobs() # if blobs: # for blob in blobs: # print "got a blob" # blob.draw(color=(0, 128, 0)) # image.show() # image.show() # time.sleep(4) Add simple logic to driver code test for easy testing
import SimpleCV as scv from SimpleCV import Image import cv2 import time from start_camera import start_camera import threading def take_50_pictures(): camera_thread = threading.Thread(target=start_camera) camera_thread.start() from get_images_from_pi import get_image, valid_image time.sleep(2) count = 0 while (count < 50): get_image(count) count += 1 def detect_stop_sign(image): reds = image.hueDistance(color=scv.Color.RED) stretch = reds.stretch(20,21) invert = stretch.invert() blobs = invert.findBlobs(minsize=2000) if blobs: for blob in blobs: print blob.area() blob.draw(color=(0, 128, 0)) invert.show() invert.show() time.sleep(3) image = Image('images/0.jpg') x = 0 while (x < 40): image = Image('images/'+ str(x) + '.jpg') detect_stop_sign(image) print x x +=1 exit()
<commit_before>import SimpleCV as scv from SimpleCV import Image import cv2 import time from start_camera import start_camera import threading # camera_thread = threading.Thread(target=start_camera) # camera_thread.start() # from get_images_from_pi import get_image, valid_image # time.sleep(2) # count = 0 # while (count < 50): # get_image(count) # count += 1 # exit() image = Image('images/stop') image.show() image.show() time.sleep(2) reds = image.hueDistance(color=scv.Color.RED) reds.show() reds.show() time.sleep(2) stretch = reds.stretch(20,21) stretch.show() stretch.show() time.sleep(3) # blobs = image.findBlobs() # if blobs: # for blob in blobs: # print "got a blob" # blob.draw(color=(0, 128, 0)) # image.show() # image.show() # time.sleep(4) <commit_msg>Add simple logic to driver code test for easy testing<commit_after>
import SimpleCV as scv from SimpleCV import Image import cv2 import time from start_camera import start_camera import threading def take_50_pictures(): camera_thread = threading.Thread(target=start_camera) camera_thread.start() from get_images_from_pi import get_image, valid_image time.sleep(2) count = 0 while (count < 50): get_image(count) count += 1 def detect_stop_sign(image): reds = image.hueDistance(color=scv.Color.RED) stretch = reds.stretch(20,21) invert = stretch.invert() blobs = invert.findBlobs(minsize=2000) if blobs: for blob in blobs: print blob.area() blob.draw(color=(0, 128, 0)) invert.show() invert.show() time.sleep(3) image = Image('images/0.jpg') x = 0 while (x < 40): image = Image('images/'+ str(x) + '.jpg') detect_stop_sign(image) print x x +=1 exit()
import SimpleCV as scv from SimpleCV import Image import cv2 import time from start_camera import start_camera import threading # camera_thread = threading.Thread(target=start_camera) # camera_thread.start() # from get_images_from_pi import get_image, valid_image # time.sleep(2) # count = 0 # while (count < 50): # get_image(count) # count += 1 # exit() image = Image('images/stop') image.show() image.show() time.sleep(2) reds = image.hueDistance(color=scv.Color.RED) reds.show() reds.show() time.sleep(2) stretch = reds.stretch(20,21) stretch.show() stretch.show() time.sleep(3) # blobs = image.findBlobs() # if blobs: # for blob in blobs: # print "got a blob" # blob.draw(color=(0, 128, 0)) # image.show() # image.show() # time.sleep(4) Add simple logic to driver code test for easy testingimport SimpleCV as scv from SimpleCV import Image import cv2 import time from start_camera import start_camera import threading def take_50_pictures(): camera_thread = threading.Thread(target=start_camera) camera_thread.start() from get_images_from_pi import get_image, valid_image time.sleep(2) count = 0 while (count < 50): get_image(count) count += 1 def detect_stop_sign(image): reds = image.hueDistance(color=scv.Color.RED) stretch = reds.stretch(20,21) invert = stretch.invert() blobs = invert.findBlobs(minsize=2000) if blobs: for blob in blobs: print blob.area() blob.draw(color=(0, 128, 0)) invert.show() invert.show() time.sleep(3) image = Image('images/0.jpg') x = 0 while (x < 40): image = Image('images/'+ str(x) + '.jpg') detect_stop_sign(image) print x x +=1 exit()
<commit_before>import SimpleCV as scv from SimpleCV import Image import cv2 import time from start_camera import start_camera import threading # camera_thread = threading.Thread(target=start_camera) # camera_thread.start() # from get_images_from_pi import get_image, valid_image # time.sleep(2) # count = 0 # while (count < 50): # get_image(count) # count += 1 # exit() image = Image('images/stop') image.show() image.show() time.sleep(2) reds = image.hueDistance(color=scv.Color.RED) reds.show() reds.show() time.sleep(2) stretch = reds.stretch(20,21) stretch.show() stretch.show() time.sleep(3) # blobs = image.findBlobs() # if blobs: # for blob in blobs: # print "got a blob" # blob.draw(color=(0, 128, 0)) # image.show() # image.show() # time.sleep(4) <commit_msg>Add simple logic to driver code test for easy testing<commit_after>import SimpleCV as scv from SimpleCV import Image import cv2 import time from start_camera import start_camera import threading def take_50_pictures(): camera_thread = threading.Thread(target=start_camera) camera_thread.start() from get_images_from_pi import get_image, valid_image time.sleep(2) count = 0 while (count < 50): get_image(count) count += 1 def detect_stop_sign(image): reds = image.hueDistance(color=scv.Color.RED) stretch = reds.stretch(20,21) invert = stretch.invert() blobs = invert.findBlobs(minsize=2000) if blobs: for blob in blobs: print blob.area() blob.draw(color=(0, 128, 0)) invert.show() invert.show() time.sleep(3) image = Image('images/0.jpg') x = 0 while (x < 40): image = Image('images/'+ str(x) + '.jpg') detect_stop_sign(image) print x x +=1 exit()
83dce279fcf157f9ca4cc2e7dbdad55db9f1f857
play.py
play.py
#!/usr/bin/python3 import readline import random import shelve import sys from src import parser from src import locations from src import classes player = classes.Player(locations, locations.start) previousNoun = '' turns = 0 while True: try: command = parser.parseCommand(input('> ')) if command is not None: hasNoun = True action = command[0] if len(command) >= 2: noun = command[1] else: hasNoun = False noun = None if previousNoun != '' and noun == 'it': noun = previousNoun try: commandResult = getattr(player, action)(action, noun, hasNoun) except AttributeError: print('You can\'t do that here.') if noun is not None: previousNoun = noun else: previousNoun = '' turns += 1 except KeyboardInterrupt: player.die()
#!/usr/bin/python3 import os import readline import random import shelve import sys os.chdir(os.path.dirname(os.path.abspath(__file__))) from src import parser from src import locations from src import classes player = classes.Player(locations, locations.start) previousNoun = '' turns = 0 while True: try: command = parser.parseCommand(input('> ')) if command is not None: hasNoun = True action = command[0] if len(command) >= 2: noun = command[1] else: hasNoun = False noun = None if previousNoun != '' and noun == 'it': noun = previousNoun try: commandResult = getattr(player, action)(action, noun, hasNoun) except AttributeError: print('You can\'t do that here.') if noun is not None: previousNoun = noun else: previousNoun = '' turns += 1 except KeyboardInterrupt: player.die()
Fix issue where game could be in wrong cwd
Fix issue where game could be in wrong cwd
Python
mit
disorientedperson/python-adventure-game,allanburleson/python-adventure-game
#!/usr/bin/python3 import readline import random import shelve import sys from src import parser from src import locations from src import classes player = classes.Player(locations, locations.start) previousNoun = '' turns = 0 while True: try: command = parser.parseCommand(input('> ')) if command is not None: hasNoun = True action = command[0] if len(command) >= 2: noun = command[1] else: hasNoun = False noun = None if previousNoun != '' and noun == 'it': noun = previousNoun try: commandResult = getattr(player, action)(action, noun, hasNoun) except AttributeError: print('You can\'t do that here.') if noun is not None: previousNoun = noun else: previousNoun = '' turns += 1 except KeyboardInterrupt: player.die() Fix issue where game could be in wrong cwd
#!/usr/bin/python3 import os import readline import random import shelve import sys os.chdir(os.path.dirname(os.path.abspath(__file__))) from src import parser from src import locations from src import classes player = classes.Player(locations, locations.start) previousNoun = '' turns = 0 while True: try: command = parser.parseCommand(input('> ')) if command is not None: hasNoun = True action = command[0] if len(command) >= 2: noun = command[1] else: hasNoun = False noun = None if previousNoun != '' and noun == 'it': noun = previousNoun try: commandResult = getattr(player, action)(action, noun, hasNoun) except AttributeError: print('You can\'t do that here.') if noun is not None: previousNoun = noun else: previousNoun = '' turns += 1 except KeyboardInterrupt: player.die()
<commit_before>#!/usr/bin/python3 import readline import random import shelve import sys from src import parser from src import locations from src import classes player = classes.Player(locations, locations.start) previousNoun = '' turns = 0 while True: try: command = parser.parseCommand(input('> ')) if command is not None: hasNoun = True action = command[0] if len(command) >= 2: noun = command[1] else: hasNoun = False noun = None if previousNoun != '' and noun == 'it': noun = previousNoun try: commandResult = getattr(player, action)(action, noun, hasNoun) except AttributeError: print('You can\'t do that here.') if noun is not None: previousNoun = noun else: previousNoun = '' turns += 1 except KeyboardInterrupt: player.die() <commit_msg>Fix issue where game could be in wrong cwd<commit_after>
#!/usr/bin/python3 import os import readline import random import shelve import sys os.chdir(os.path.dirname(os.path.abspath(__file__))) from src import parser from src import locations from src import classes player = classes.Player(locations, locations.start) previousNoun = '' turns = 0 while True: try: command = parser.parseCommand(input('> ')) if command is not None: hasNoun = True action = command[0] if len(command) >= 2: noun = command[1] else: hasNoun = False noun = None if previousNoun != '' and noun == 'it': noun = previousNoun try: commandResult = getattr(player, action)(action, noun, hasNoun) except AttributeError: print('You can\'t do that here.') if noun is not None: previousNoun = noun else: previousNoun = '' turns += 1 except KeyboardInterrupt: player.die()
#!/usr/bin/python3 import readline import random import shelve import sys from src import parser from src import locations from src import classes player = classes.Player(locations, locations.start) previousNoun = '' turns = 0 while True: try: command = parser.parseCommand(input('> ')) if command is not None: hasNoun = True action = command[0] if len(command) >= 2: noun = command[1] else: hasNoun = False noun = None if previousNoun != '' and noun == 'it': noun = previousNoun try: commandResult = getattr(player, action)(action, noun, hasNoun) except AttributeError: print('You can\'t do that here.') if noun is not None: previousNoun = noun else: previousNoun = '' turns += 1 except KeyboardInterrupt: player.die() Fix issue where game could be in wrong cwd#!/usr/bin/python3 import os import readline import random import shelve import sys os.chdir(os.path.dirname(os.path.abspath(__file__))) from src import parser from src import locations from src import classes player = classes.Player(locations, locations.start) previousNoun = '' turns = 0 while True: try: command = parser.parseCommand(input('> ')) if command is not None: hasNoun = True action = command[0] if len(command) >= 2: noun = command[1] else: hasNoun = False noun = None if previousNoun != '' and noun == 'it': noun = previousNoun try: commandResult = getattr(player, action)(action, noun, hasNoun) except AttributeError: print('You can\'t do that here.') if noun is not None: previousNoun = noun else: previousNoun = '' turns += 1 except KeyboardInterrupt: player.die()
<commit_before>#!/usr/bin/python3 import readline import random import shelve import sys from src import parser from src import locations from src import classes player = classes.Player(locations, locations.start) previousNoun = '' turns = 0 while True: try: command = parser.parseCommand(input('> ')) if command is not None: hasNoun = True action = command[0] if len(command) >= 2: noun = command[1] else: hasNoun = False noun = None if previousNoun != '' and noun == 'it': noun = previousNoun try: commandResult = getattr(player, action)(action, noun, hasNoun) except AttributeError: print('You can\'t do that here.') if noun is not None: previousNoun = noun else: previousNoun = '' turns += 1 except KeyboardInterrupt: player.die() <commit_msg>Fix issue where game could be in wrong cwd<commit_after>#!/usr/bin/python3 import os import readline import random import shelve import sys os.chdir(os.path.dirname(os.path.abspath(__file__))) from src import parser from src import locations from src import classes player = classes.Player(locations, locations.start) previousNoun = '' turns = 0 while True: try: command = parser.parseCommand(input('> ')) if command is not None: hasNoun = True action = command[0] if len(command) >= 2: noun = command[1] else: hasNoun = False noun = None if previousNoun != '' and noun == 'it': noun = previousNoun try: commandResult = getattr(player, action)(action, noun, hasNoun) except AttributeError: print('You can\'t do that here.') if noun is not None: previousNoun = noun else: previousNoun = '' turns += 1 except KeyboardInterrupt: player.die()
5278af1e7de42d4e881a0888074a02cce2831591
utils.py
utils.py
from pylab import * import rebound as re def outer_solar_system(): sim = re.Simulation() sim.add(['Sun', 'Jupiter', 'Saturn', 'Uranus', 'Neptune']) sim.move_to_com() sim.dt = 4 sim.integrator = 'whfast' sim.integrator_whfast_safe_mode = 0 sim.integrator_whfast_corrector = 11 return sim def add_canonical_planar_perturber(sim): sim.add(m=3e-5, a=700, e=0.6, inc=abs(randn()*pi/180.0), Omega=2*pi*rand(), omega=2*pi*rand(), l=2*pi*rand()) return sim
from pylab import * import rebound as re def outer_solar_system(): sim = re.Simulation() sim.add(['Sun', 'Jupiter', 'Saturn', 'Uranus', 'Neptune']) sim.move_to_com() sim.dt = 4 sim.integrator = 'whfast' sim.integrator_whfast_safe_mode = 0 sim.integrator_whfast_corrector = 11 return sim def add_canonical_planar_perturber(sim): sim.add(m=3e-5, a=700, e=0.6, pomega=2*pi*rand(), l=2*pi*rand()) return sim
Make planar perturber *really* planar.
Make planar perturber *really* planar.
Python
mit
farr/PlanetIX
from pylab import * import rebound as re def outer_solar_system(): sim = re.Simulation() sim.add(['Sun', 'Jupiter', 'Saturn', 'Uranus', 'Neptune']) sim.move_to_com() sim.dt = 4 sim.integrator = 'whfast' sim.integrator_whfast_safe_mode = 0 sim.integrator_whfast_corrector = 11 return sim def add_canonical_planar_perturber(sim): sim.add(m=3e-5, a=700, e=0.6, inc=abs(randn()*pi/180.0), Omega=2*pi*rand(), omega=2*pi*rand(), l=2*pi*rand()) return sim Make planar perturber *really* planar.
from pylab import * import rebound as re def outer_solar_system(): sim = re.Simulation() sim.add(['Sun', 'Jupiter', 'Saturn', 'Uranus', 'Neptune']) sim.move_to_com() sim.dt = 4 sim.integrator = 'whfast' sim.integrator_whfast_safe_mode = 0 sim.integrator_whfast_corrector = 11 return sim def add_canonical_planar_perturber(sim): sim.add(m=3e-5, a=700, e=0.6, pomega=2*pi*rand(), l=2*pi*rand()) return sim
<commit_before>from pylab import * import rebound as re def outer_solar_system(): sim = re.Simulation() sim.add(['Sun', 'Jupiter', 'Saturn', 'Uranus', 'Neptune']) sim.move_to_com() sim.dt = 4 sim.integrator = 'whfast' sim.integrator_whfast_safe_mode = 0 sim.integrator_whfast_corrector = 11 return sim def add_canonical_planar_perturber(sim): sim.add(m=3e-5, a=700, e=0.6, inc=abs(randn()*pi/180.0), Omega=2*pi*rand(), omega=2*pi*rand(), l=2*pi*rand()) return sim <commit_msg>Make planar perturber *really* planar.<commit_after>
from pylab import * import rebound as re def outer_solar_system(): sim = re.Simulation() sim.add(['Sun', 'Jupiter', 'Saturn', 'Uranus', 'Neptune']) sim.move_to_com() sim.dt = 4 sim.integrator = 'whfast' sim.integrator_whfast_safe_mode = 0 sim.integrator_whfast_corrector = 11 return sim def add_canonical_planar_perturber(sim): sim.add(m=3e-5, a=700, e=0.6, pomega=2*pi*rand(), l=2*pi*rand()) return sim
from pylab import * import rebound as re def outer_solar_system(): sim = re.Simulation() sim.add(['Sun', 'Jupiter', 'Saturn', 'Uranus', 'Neptune']) sim.move_to_com() sim.dt = 4 sim.integrator = 'whfast' sim.integrator_whfast_safe_mode = 0 sim.integrator_whfast_corrector = 11 return sim def add_canonical_planar_perturber(sim): sim.add(m=3e-5, a=700, e=0.6, inc=abs(randn()*pi/180.0), Omega=2*pi*rand(), omega=2*pi*rand(), l=2*pi*rand()) return sim Make planar perturber *really* planar.from pylab import * import rebound as re def outer_solar_system(): sim = re.Simulation() sim.add(['Sun', 'Jupiter', 'Saturn', 'Uranus', 'Neptune']) sim.move_to_com() sim.dt = 4 sim.integrator = 'whfast' sim.integrator_whfast_safe_mode = 0 sim.integrator_whfast_corrector = 11 return sim def add_canonical_planar_perturber(sim): sim.add(m=3e-5, a=700, e=0.6, pomega=2*pi*rand(), l=2*pi*rand()) return sim
<commit_before>from pylab import * import rebound as re def outer_solar_system(): sim = re.Simulation() sim.add(['Sun', 'Jupiter', 'Saturn', 'Uranus', 'Neptune']) sim.move_to_com() sim.dt = 4 sim.integrator = 'whfast' sim.integrator_whfast_safe_mode = 0 sim.integrator_whfast_corrector = 11 return sim def add_canonical_planar_perturber(sim): sim.add(m=3e-5, a=700, e=0.6, inc=abs(randn()*pi/180.0), Omega=2*pi*rand(), omega=2*pi*rand(), l=2*pi*rand()) return sim <commit_msg>Make planar perturber *really* planar.<commit_after>from pylab import * import rebound as re def outer_solar_system(): sim = re.Simulation() sim.add(['Sun', 'Jupiter', 'Saturn', 'Uranus', 'Neptune']) sim.move_to_com() sim.dt = 4 sim.integrator = 'whfast' sim.integrator_whfast_safe_mode = 0 sim.integrator_whfast_corrector = 11 return sim def add_canonical_planar_perturber(sim): sim.add(m=3e-5, a=700, e=0.6, pomega=2*pi*rand(), l=2*pi*rand()) return sim
e5f88d065601972bf1e7abebc69f9235b08d4c62
easyium/__init__.py
easyium/__init__.py
__author__ = 'karl.gong' try: import appium appium_installed = True except ImportError: appium_installed = False
from .webdriver import WebDriver, WebDriverType from .staticelement import StaticElement from .identifier import Identifier from .waits.waiter import wait_for __author__ = 'karl.gong' try: import appium appium_installed = True except ImportError: appium_installed = False
Add package "shortcuts" for classes&function
Add package "shortcuts" for classes&function
Python
apache-2.0
KarlGong/easyium-python,KarlGong/easyium
__author__ = 'karl.gong' try: import appium appium_installed = True except ImportError: appium_installed = FalseAdd package "shortcuts" for classes&function
from .webdriver import WebDriver, WebDriverType from .staticelement import StaticElement from .identifier import Identifier from .waits.waiter import wait_for __author__ = 'karl.gong' try: import appium appium_installed = True except ImportError: appium_installed = False
<commit_before>__author__ = 'karl.gong' try: import appium appium_installed = True except ImportError: appium_installed = False<commit_msg>Add package "shortcuts" for classes&function<commit_after>
from .webdriver import WebDriver, WebDriverType from .staticelement import StaticElement from .identifier import Identifier from .waits.waiter import wait_for __author__ = 'karl.gong' try: import appium appium_installed = True except ImportError: appium_installed = False
__author__ = 'karl.gong' try: import appium appium_installed = True except ImportError: appium_installed = FalseAdd package "shortcuts" for classes&functionfrom .webdriver import WebDriver, WebDriverType from .staticelement import StaticElement from .identifier import Identifier from .waits.waiter import wait_for __author__ = 'karl.gong' try: import appium appium_installed = True except ImportError: appium_installed = False
<commit_before>__author__ = 'karl.gong' try: import appium appium_installed = True except ImportError: appium_installed = False<commit_msg>Add package "shortcuts" for classes&function<commit_after>from .webdriver import WebDriver, WebDriverType from .staticelement import StaticElement from .identifier import Identifier from .waits.waiter import wait_for __author__ = 'karl.gong' try: import appium appium_installed = True except ImportError: appium_installed = False
fc23b7e6a330bd24d49edb60df3a7e8d948c6c32
main.py
main.py
from kivy.app import App from kivy.uix.widget import Widget from kivy.clock import Clock from kivy.graphics import Canvas, Color, Rectangle from action_map import ActionMap from camera import Camera from graphics import Graphics class ActionGame(Widget): action_map = ActionMap() graphics = Graphics() def __init__(self, **kwargs): super().__init__(**kwargs) self.camera = Camera(self.graphics, self.action_map) self.add_widget(self.camera) self.bind(size=self.resize) def update(self, dt): self.camera.update() def on_touch_down(self, touch): self.last_touch_x = touch.x self.last_touch_y = touch.y def on_touch_move(self, touch): self.camera.change_pos_by(self.last_touch_x - touch.x, self.last_touch_y - touch.y ) self.last_touch_x = touch.x self.last_touch_y = touch.y def resize(self, instance, value): self.camera.resize(self) class ActionApp(App): def build(self): game = ActionGame() Clock.schedule_interval(game.update, 1.0 / 60.0) return game if __name__ == '__main__': ActionApp().run()
from kivy.app import App from kivy.uix.widget import Widget from kivy.clock import Clock from kivy.graphics import Canvas, Color, Rectangle from action_map import ActionMap from camera import Camera from graphics import Graphics class ActionGame(Widget): action_map = ActionMap() graphics = Graphics() def __init__(self, **kwargs): super().__init__(**kwargs) self.camera = Camera(self.graphics, self.action_map) self.add_widget(self.camera) self.bind(size=self.resize) def update(self, dt): self.camera.update() def on_touch_move(self, touch): self.camera.change_pos_by(-touch.dx, -touch.dy) def resize(self, instance, value): self.camera.resize(self) class ActionApp(App): def build(self): game = ActionGame() Clock.schedule_interval(game.update, 1.0 / 60.0) return game if __name__ == '__main__': ActionApp().run()
Simplify camera response to touch input
Simplify camera response to touch input
Python
mit
Corrob/Action-Game
from kivy.app import App from kivy.uix.widget import Widget from kivy.clock import Clock from kivy.graphics import Canvas, Color, Rectangle from action_map import ActionMap from camera import Camera from graphics import Graphics class ActionGame(Widget): action_map = ActionMap() graphics = Graphics() def __init__(self, **kwargs): super().__init__(**kwargs) self.camera = Camera(self.graphics, self.action_map) self.add_widget(self.camera) self.bind(size=self.resize) def update(self, dt): self.camera.update() def on_touch_down(self, touch): self.last_touch_x = touch.x self.last_touch_y = touch.y def on_touch_move(self, touch): self.camera.change_pos_by(self.last_touch_x - touch.x, self.last_touch_y - touch.y ) self.last_touch_x = touch.x self.last_touch_y = touch.y def resize(self, instance, value): self.camera.resize(self) class ActionApp(App): def build(self): game = ActionGame() Clock.schedule_interval(game.update, 1.0 / 60.0) return game if __name__ == '__main__': ActionApp().run() Simplify camera response to touch input
from kivy.app import App from kivy.uix.widget import Widget from kivy.clock import Clock from kivy.graphics import Canvas, Color, Rectangle from action_map import ActionMap from camera import Camera from graphics import Graphics class ActionGame(Widget): action_map = ActionMap() graphics = Graphics() def __init__(self, **kwargs): super().__init__(**kwargs) self.camera = Camera(self.graphics, self.action_map) self.add_widget(self.camera) self.bind(size=self.resize) def update(self, dt): self.camera.update() def on_touch_move(self, touch): self.camera.change_pos_by(-touch.dx, -touch.dy) def resize(self, instance, value): self.camera.resize(self) class ActionApp(App): def build(self): game = ActionGame() Clock.schedule_interval(game.update, 1.0 / 60.0) return game if __name__ == '__main__': ActionApp().run()
<commit_before>from kivy.app import App from kivy.uix.widget import Widget from kivy.clock import Clock from kivy.graphics import Canvas, Color, Rectangle from action_map import ActionMap from camera import Camera from graphics import Graphics class ActionGame(Widget): action_map = ActionMap() graphics = Graphics() def __init__(self, **kwargs): super().__init__(**kwargs) self.camera = Camera(self.graphics, self.action_map) self.add_widget(self.camera) self.bind(size=self.resize) def update(self, dt): self.camera.update() def on_touch_down(self, touch): self.last_touch_x = touch.x self.last_touch_y = touch.y def on_touch_move(self, touch): self.camera.change_pos_by(self.last_touch_x - touch.x, self.last_touch_y - touch.y ) self.last_touch_x = touch.x self.last_touch_y = touch.y def resize(self, instance, value): self.camera.resize(self) class ActionApp(App): def build(self): game = ActionGame() Clock.schedule_interval(game.update, 1.0 / 60.0) return game if __name__ == '__main__': ActionApp().run() <commit_msg>Simplify camera response to touch input<commit_after>
from kivy.app import App from kivy.uix.widget import Widget from kivy.clock import Clock from kivy.graphics import Canvas, Color, Rectangle from action_map import ActionMap from camera import Camera from graphics import Graphics class ActionGame(Widget): action_map = ActionMap() graphics = Graphics() def __init__(self, **kwargs): super().__init__(**kwargs) self.camera = Camera(self.graphics, self.action_map) self.add_widget(self.camera) self.bind(size=self.resize) def update(self, dt): self.camera.update() def on_touch_move(self, touch): self.camera.change_pos_by(-touch.dx, -touch.dy) def resize(self, instance, value): self.camera.resize(self) class ActionApp(App): def build(self): game = ActionGame() Clock.schedule_interval(game.update, 1.0 / 60.0) return game if __name__ == '__main__': ActionApp().run()
from kivy.app import App from kivy.uix.widget import Widget from kivy.clock import Clock from kivy.graphics import Canvas, Color, Rectangle from action_map import ActionMap from camera import Camera from graphics import Graphics class ActionGame(Widget): action_map = ActionMap() graphics = Graphics() def __init__(self, **kwargs): super().__init__(**kwargs) self.camera = Camera(self.graphics, self.action_map) self.add_widget(self.camera) self.bind(size=self.resize) def update(self, dt): self.camera.update() def on_touch_down(self, touch): self.last_touch_x = touch.x self.last_touch_y = touch.y def on_touch_move(self, touch): self.camera.change_pos_by(self.last_touch_x - touch.x, self.last_touch_y - touch.y ) self.last_touch_x = touch.x self.last_touch_y = touch.y def resize(self, instance, value): self.camera.resize(self) class ActionApp(App): def build(self): game = ActionGame() Clock.schedule_interval(game.update, 1.0 / 60.0) return game if __name__ == '__main__': ActionApp().run() Simplify camera response to touch inputfrom kivy.app import App from kivy.uix.widget import Widget from kivy.clock import Clock from kivy.graphics import Canvas, Color, Rectangle from action_map import ActionMap from camera import Camera from graphics import Graphics class ActionGame(Widget): action_map = ActionMap() graphics = Graphics() def __init__(self, **kwargs): super().__init__(**kwargs) self.camera = Camera(self.graphics, self.action_map) self.add_widget(self.camera) self.bind(size=self.resize) def update(self, dt): self.camera.update() def on_touch_move(self, touch): self.camera.change_pos_by(-touch.dx, -touch.dy) def resize(self, instance, value): self.camera.resize(self) class ActionApp(App): def build(self): game = ActionGame() Clock.schedule_interval(game.update, 1.0 / 60.0) return game if __name__ == '__main__': ActionApp().run()
<commit_before>from kivy.app import App from kivy.uix.widget import Widget from kivy.clock import Clock from kivy.graphics import Canvas, Color, Rectangle from action_map import ActionMap from camera import Camera from graphics import Graphics class ActionGame(Widget): action_map = ActionMap() graphics = Graphics() def __init__(self, **kwargs): super().__init__(**kwargs) self.camera = Camera(self.graphics, self.action_map) self.add_widget(self.camera) self.bind(size=self.resize) def update(self, dt): self.camera.update() def on_touch_down(self, touch): self.last_touch_x = touch.x self.last_touch_y = touch.y def on_touch_move(self, touch): self.camera.change_pos_by(self.last_touch_x - touch.x, self.last_touch_y - touch.y ) self.last_touch_x = touch.x self.last_touch_y = touch.y def resize(self, instance, value): self.camera.resize(self) class ActionApp(App): def build(self): game = ActionGame() Clock.schedule_interval(game.update, 1.0 / 60.0) return game if __name__ == '__main__': ActionApp().run() <commit_msg>Simplify camera response to touch input<commit_after>from kivy.app import App from kivy.uix.widget import Widget from kivy.clock import Clock from kivy.graphics import Canvas, Color, Rectangle from action_map import ActionMap from camera import Camera from graphics import Graphics class ActionGame(Widget): action_map = ActionMap() graphics = Graphics() def __init__(self, **kwargs): super().__init__(**kwargs) self.camera = Camera(self.graphics, self.action_map) self.add_widget(self.camera) self.bind(size=self.resize) def update(self, dt): self.camera.update() def on_touch_move(self, touch): self.camera.change_pos_by(-touch.dx, -touch.dy) def resize(self, instance, value): self.camera.resize(self) class ActionApp(App): def build(self): game = ActionGame() Clock.schedule_interval(game.update, 1.0 / 60.0) return game if __name__ == '__main__': ActionApp().run()
c51fd4f744b2b420080500e21d78b4fda17bdccf
main.py
main.py
from flask import Flask from flask import jsonify from slack_helper import SlackHelper import os app = Flask(__name__) slack_helper = SlackHelper() @app.route("/") def hello(): return "Bedlam Slack Slash Commands" @app.route("/slash/random-number", methods=['POST']) def random(): if not slack_helper.validate_request(): abort(403) # chosen by fair dice roll # guarenteed to be random response = { "response_type": "in_channel", "text": "Your random number is: 4" } return jsonify(response) @app.route("/slash/cat-gif", methods=['POST']) def random_cat_gif(): if not slack_helper.validate_request(): abort(403) response = { "response_type": "in_channel", "text": "Here is your random cat:", "attachments" : [ { "image_url" : "http://thecatapi.com/api/images/get?format=src&type=gif" } ] } return jsonify(response) @app.route("/slash/echo", methods=['POST']) def echo(): return "hello" @app.route("/test/env", methods=["GET"]) def test_environment(): return os.environ["TEST_ENV_VALUE"] if __name__ == "__main__": app.run(debug=True)
from flask import Flask from flask import jsonify from slack_helper import SlackHelper import os app = Flask(__name__) slack_helper = SlackHelper() @app.route("/") def hello(): return "Bedlam Slack Slash Commands" @app.route("/slash/random-number", methods=['POST']) def random(): if not slack_helper.validate_request(): abort(403) # chosen by fair dice roll # guarenteed to be random response = { "response_type": "in_channel", "text": "Your random number is: 4" } return jsonify(response) @app.route("/slash/cat-gif", methods=['POST']) def random_cat_gif(): if not slack_helper.validate_request(): abort(403) response = { "attachments" : [ { "fallback" : "A cat gif", "title" : "Random cat gif", "image_url" : "http://thecatapi.com/api/images/get?format=src&type=gif" } ] } return jsonify(response) @app.route("/slash/echo", methods=['POST']) def echo(): return "hello" @app.route("/test/env", methods=["GET"]) def test_environment(): return os.environ["TEST_ENV_VALUE"] if __name__ == "__main__": app.run(debug=True)
Update to cat gif code
Update to cat gif code
Python
mit
martinpeck/bedlam-slack,martinpeck/bedlam-slack
from flask import Flask from flask import jsonify from slack_helper import SlackHelper import os app = Flask(__name__) slack_helper = SlackHelper() @app.route("/") def hello(): return "Bedlam Slack Slash Commands" @app.route("/slash/random-number", methods=['POST']) def random(): if not slack_helper.validate_request(): abort(403) # chosen by fair dice roll # guarenteed to be random response = { "response_type": "in_channel", "text": "Your random number is: 4" } return jsonify(response) @app.route("/slash/cat-gif", methods=['POST']) def random_cat_gif(): if not slack_helper.validate_request(): abort(403) response = { "response_type": "in_channel", "text": "Here is your random cat:", "attachments" : [ { "image_url" : "http://thecatapi.com/api/images/get?format=src&type=gif" } ] } return jsonify(response) @app.route("/slash/echo", methods=['POST']) def echo(): return "hello" @app.route("/test/env", methods=["GET"]) def test_environment(): return os.environ["TEST_ENV_VALUE"] if __name__ == "__main__": app.run(debug=True) Update to cat gif code
from flask import Flask from flask import jsonify from slack_helper import SlackHelper import os app = Flask(__name__) slack_helper = SlackHelper() @app.route("/") def hello(): return "Bedlam Slack Slash Commands" @app.route("/slash/random-number", methods=['POST']) def random(): if not slack_helper.validate_request(): abort(403) # chosen by fair dice roll # guarenteed to be random response = { "response_type": "in_channel", "text": "Your random number is: 4" } return jsonify(response) @app.route("/slash/cat-gif", methods=['POST']) def random_cat_gif(): if not slack_helper.validate_request(): abort(403) response = { "attachments" : [ { "fallback" : "A cat gif", "title" : "Random cat gif", "image_url" : "http://thecatapi.com/api/images/get?format=src&type=gif" } ] } return jsonify(response) @app.route("/slash/echo", methods=['POST']) def echo(): return "hello" @app.route("/test/env", methods=["GET"]) def test_environment(): return os.environ["TEST_ENV_VALUE"] if __name__ == "__main__": app.run(debug=True)
<commit_before>from flask import Flask from flask import jsonify from slack_helper import SlackHelper import os app = Flask(__name__) slack_helper = SlackHelper() @app.route("/") def hello(): return "Bedlam Slack Slash Commands" @app.route("/slash/random-number", methods=['POST']) def random(): if not slack_helper.validate_request(): abort(403) # chosen by fair dice roll # guarenteed to be random response = { "response_type": "in_channel", "text": "Your random number is: 4" } return jsonify(response) @app.route("/slash/cat-gif", methods=['POST']) def random_cat_gif(): if not slack_helper.validate_request(): abort(403) response = { "response_type": "in_channel", "text": "Here is your random cat:", "attachments" : [ { "image_url" : "http://thecatapi.com/api/images/get?format=src&type=gif" } ] } return jsonify(response) @app.route("/slash/echo", methods=['POST']) def echo(): return "hello" @app.route("/test/env", methods=["GET"]) def test_environment(): return os.environ["TEST_ENV_VALUE"] if __name__ == "__main__": app.run(debug=True) <commit_msg>Update to cat gif code<commit_after>
from flask import Flask from flask import jsonify from slack_helper import SlackHelper import os app = Flask(__name__) slack_helper = SlackHelper() @app.route("/") def hello(): return "Bedlam Slack Slash Commands" @app.route("/slash/random-number", methods=['POST']) def random(): if not slack_helper.validate_request(): abort(403) # chosen by fair dice roll # guarenteed to be random response = { "response_type": "in_channel", "text": "Your random number is: 4" } return jsonify(response) @app.route("/slash/cat-gif", methods=['POST']) def random_cat_gif(): if not slack_helper.validate_request(): abort(403) response = { "attachments" : [ { "fallback" : "A cat gif", "title" : "Random cat gif", "image_url" : "http://thecatapi.com/api/images/get?format=src&type=gif" } ] } return jsonify(response) @app.route("/slash/echo", methods=['POST']) def echo(): return "hello" @app.route("/test/env", methods=["GET"]) def test_environment(): return os.environ["TEST_ENV_VALUE"] if __name__ == "__main__": app.run(debug=True)
from flask import Flask from flask import jsonify from slack_helper import SlackHelper import os app = Flask(__name__) slack_helper = SlackHelper() @app.route("/") def hello(): return "Bedlam Slack Slash Commands" @app.route("/slash/random-number", methods=['POST']) def random(): if not slack_helper.validate_request(): abort(403) # chosen by fair dice roll # guarenteed to be random response = { "response_type": "in_channel", "text": "Your random number is: 4" } return jsonify(response) @app.route("/slash/cat-gif", methods=['POST']) def random_cat_gif(): if not slack_helper.validate_request(): abort(403) response = { "response_type": "in_channel", "text": "Here is your random cat:", "attachments" : [ { "image_url" : "http://thecatapi.com/api/images/get?format=src&type=gif" } ] } return jsonify(response) @app.route("/slash/echo", methods=['POST']) def echo(): return "hello" @app.route("/test/env", methods=["GET"]) def test_environment(): return os.environ["TEST_ENV_VALUE"] if __name__ == "__main__": app.run(debug=True) Update to cat gif codefrom flask import Flask from flask import jsonify from slack_helper import SlackHelper import os app = Flask(__name__) slack_helper = SlackHelper() @app.route("/") def hello(): return "Bedlam Slack Slash Commands" @app.route("/slash/random-number", methods=['POST']) def random(): if not slack_helper.validate_request(): abort(403) # chosen by fair dice roll # guarenteed to be random response = { "response_type": "in_channel", "text": "Your random number is: 4" } return jsonify(response) @app.route("/slash/cat-gif", methods=['POST']) def random_cat_gif(): if not slack_helper.validate_request(): abort(403) response = { "attachments" : [ { "fallback" : "A cat gif", "title" : "Random cat gif", "image_url" : "http://thecatapi.com/api/images/get?format=src&type=gif" } ] } return jsonify(response) @app.route("/slash/echo", methods=['POST']) def echo(): return "hello" @app.route("/test/env", methods=["GET"]) def test_environment(): return os.environ["TEST_ENV_VALUE"] if __name__ == "__main__": app.run(debug=True)
<commit_before>from flask import Flask from flask import jsonify from slack_helper import SlackHelper import os app = Flask(__name__) slack_helper = SlackHelper() @app.route("/") def hello(): return "Bedlam Slack Slash Commands" @app.route("/slash/random-number", methods=['POST']) def random(): if not slack_helper.validate_request(): abort(403) # chosen by fair dice roll # guarenteed to be random response = { "response_type": "in_channel", "text": "Your random number is: 4" } return jsonify(response) @app.route("/slash/cat-gif", methods=['POST']) def random_cat_gif(): if not slack_helper.validate_request(): abort(403) response = { "response_type": "in_channel", "text": "Here is your random cat:", "attachments" : [ { "image_url" : "http://thecatapi.com/api/images/get?format=src&type=gif" } ] } return jsonify(response) @app.route("/slash/echo", methods=['POST']) def echo(): return "hello" @app.route("/test/env", methods=["GET"]) def test_environment(): return os.environ["TEST_ENV_VALUE"] if __name__ == "__main__": app.run(debug=True) <commit_msg>Update to cat gif code<commit_after>from flask import Flask from flask import jsonify from slack_helper import SlackHelper import os app = Flask(__name__) slack_helper = SlackHelper() @app.route("/") def hello(): return "Bedlam Slack Slash Commands" @app.route("/slash/random-number", methods=['POST']) def random(): if not slack_helper.validate_request(): abort(403) # chosen by fair dice roll # guarenteed to be random response = { "response_type": "in_channel", "text": "Your random number is: 4" } return jsonify(response) @app.route("/slash/cat-gif", methods=['POST']) def random_cat_gif(): if not slack_helper.validate_request(): abort(403) response = { "attachments" : [ { "fallback" : "A cat gif", "title" : "Random cat gif", "image_url" : "http://thecatapi.com/api/images/get?format=src&type=gif" } ] } return jsonify(response) @app.route("/slash/echo", methods=['POST']) def echo(): return "hello" @app.route("/test/env", methods=["GET"]) def test_environment(): return os.environ["TEST_ENV_VALUE"] if __name__ == "__main__": app.run(debug=True)
6f8692d0345652acc5e4c858e0e2a3f688dc574f
project/views/twilioviews.py
project/views/twilioviews.py
from flask import request import requests from ..utils.status import get_status from ..utils.reminders import create_reminder import twilio.twiml import json import dateutil def call(): resp = twilio.twiml.Response() resp.record(timeout=10, transcribe=True, transcribeCallback='http://queri.me/rec', ) return str(resp) def text(): b = request.form.get('Body','') phone = request.form.get('From','') wit = requests.get('https://api.wit.ai/message?v=20140905&q=%s' % b, headers={'Authorization':'Bearer L3VB34V6YTDFO4BRXNDQNAYMVOOF4BHB'}).text intent = json.loads(wit)['outcomes'][0]['intent'] print json.loads(wit) if intent == 'get_status': m = get_status(wit, phone) elif intent == 'remind': entities = json.loads(wit)['outcomes'][0]['entities'] date = dateutil.parser.parse(entities['time'][0]['value']['from']) text = entities['message'] m = create_reminder(date, text, phone) else: m = "Hmm? Try again please :(" # Send to wit.ai for processing resp = twilio.twiml.Response() resp.message(m) return str(resp) def rec(): print request.form.get('TranscriptionText','') return ''
from flask import request import requests from ..utils.status import get_status from ..utils.reminders import create_reminder import twilio.twiml import json import dateutil def call(): resp = twilio.twiml.Response() resp.record(timeout=10, transcribe=True, transcribeCallback='http://queri.me/rec', ) return str(resp) def text(): b = request.form.get('Body','') phone = request.form.get('From','') wit = requests.get('https://api.wit.ai/message?v=20140905&q=%s' % b, headers={'Authorization':'Bearer L3VB34V6YTDFO4BRXNDQNAYMVOOF4BHB'}).text intent = json.loads(wit)['outcomes'][0]['intent'] print json.loads(wit) if intent == 'get_status': m = get_status(wit, phone) elif intent == 'remind': entities = json.loads(wit)['outcomes'][0]['entities'] date = dateutil.parser.parse(entities['time'][0]['value']['from']) text = entities['message'][0]['value'] m = create_reminder(date, text, phone) else: m = "Hmm? Try again please :(" # Send to wit.ai for processing resp = twilio.twiml.Response() resp.message(m) return str(resp) def rec(): print request.form.get('TranscriptionText','') return ''
Select the message text in twilio
Select the message text in twilio
Python
apache-2.0
tjcsl/mhacksiv
from flask import request import requests from ..utils.status import get_status from ..utils.reminders import create_reminder import twilio.twiml import json import dateutil def call(): resp = twilio.twiml.Response() resp.record(timeout=10, transcribe=True, transcribeCallback='http://queri.me/rec', ) return str(resp) def text(): b = request.form.get('Body','') phone = request.form.get('From','') wit = requests.get('https://api.wit.ai/message?v=20140905&q=%s' % b, headers={'Authorization':'Bearer L3VB34V6YTDFO4BRXNDQNAYMVOOF4BHB'}).text intent = json.loads(wit)['outcomes'][0]['intent'] print json.loads(wit) if intent == 'get_status': m = get_status(wit, phone) elif intent == 'remind': entities = json.loads(wit)['outcomes'][0]['entities'] date = dateutil.parser.parse(entities['time'][0]['value']['from']) text = entities['message'] m = create_reminder(date, text, phone) else: m = "Hmm? Try again please :(" # Send to wit.ai for processing resp = twilio.twiml.Response() resp.message(m) return str(resp) def rec(): print request.form.get('TranscriptionText','') return '' Select the message text in twilio
from flask import request import requests from ..utils.status import get_status from ..utils.reminders import create_reminder import twilio.twiml import json import dateutil def call(): resp = twilio.twiml.Response() resp.record(timeout=10, transcribe=True, transcribeCallback='http://queri.me/rec', ) return str(resp) def text(): b = request.form.get('Body','') phone = request.form.get('From','') wit = requests.get('https://api.wit.ai/message?v=20140905&q=%s' % b, headers={'Authorization':'Bearer L3VB34V6YTDFO4BRXNDQNAYMVOOF4BHB'}).text intent = json.loads(wit)['outcomes'][0]['intent'] print json.loads(wit) if intent == 'get_status': m = get_status(wit, phone) elif intent == 'remind': entities = json.loads(wit)['outcomes'][0]['entities'] date = dateutil.parser.parse(entities['time'][0]['value']['from']) text = entities['message'][0]['value'] m = create_reminder(date, text, phone) else: m = "Hmm? Try again please :(" # Send to wit.ai for processing resp = twilio.twiml.Response() resp.message(m) return str(resp) def rec(): print request.form.get('TranscriptionText','') return ''
<commit_before>from flask import request import requests from ..utils.status import get_status from ..utils.reminders import create_reminder import twilio.twiml import json import dateutil def call(): resp = twilio.twiml.Response() resp.record(timeout=10, transcribe=True, transcribeCallback='http://queri.me/rec', ) return str(resp) def text(): b = request.form.get('Body','') phone = request.form.get('From','') wit = requests.get('https://api.wit.ai/message?v=20140905&q=%s' % b, headers={'Authorization':'Bearer L3VB34V6YTDFO4BRXNDQNAYMVOOF4BHB'}).text intent = json.loads(wit)['outcomes'][0]['intent'] print json.loads(wit) if intent == 'get_status': m = get_status(wit, phone) elif intent == 'remind': entities = json.loads(wit)['outcomes'][0]['entities'] date = dateutil.parser.parse(entities['time'][0]['value']['from']) text = entities['message'] m = create_reminder(date, text, phone) else: m = "Hmm? Try again please :(" # Send to wit.ai for processing resp = twilio.twiml.Response() resp.message(m) return str(resp) def rec(): print request.form.get('TranscriptionText','') return '' <commit_msg>Select the message text in twilio<commit_after>
from flask import request import requests from ..utils.status import get_status from ..utils.reminders import create_reminder import twilio.twiml import json import dateutil def call(): resp = twilio.twiml.Response() resp.record(timeout=10, transcribe=True, transcribeCallback='http://queri.me/rec', ) return str(resp) def text(): b = request.form.get('Body','') phone = request.form.get('From','') wit = requests.get('https://api.wit.ai/message?v=20140905&q=%s' % b, headers={'Authorization':'Bearer L3VB34V6YTDFO4BRXNDQNAYMVOOF4BHB'}).text intent = json.loads(wit)['outcomes'][0]['intent'] print json.loads(wit) if intent == 'get_status': m = get_status(wit, phone) elif intent == 'remind': entities = json.loads(wit)['outcomes'][0]['entities'] date = dateutil.parser.parse(entities['time'][0]['value']['from']) text = entities['message'][0]['value'] m = create_reminder(date, text, phone) else: m = "Hmm? Try again please :(" # Send to wit.ai for processing resp = twilio.twiml.Response() resp.message(m) return str(resp) def rec(): print request.form.get('TranscriptionText','') return ''
from flask import request import requests from ..utils.status import get_status from ..utils.reminders import create_reminder import twilio.twiml import json import dateutil def call(): resp = twilio.twiml.Response() resp.record(timeout=10, transcribe=True, transcribeCallback='http://queri.me/rec', ) return str(resp) def text(): b = request.form.get('Body','') phone = request.form.get('From','') wit = requests.get('https://api.wit.ai/message?v=20140905&q=%s' % b, headers={'Authorization':'Bearer L3VB34V6YTDFO4BRXNDQNAYMVOOF4BHB'}).text intent = json.loads(wit)['outcomes'][0]['intent'] print json.loads(wit) if intent == 'get_status': m = get_status(wit, phone) elif intent == 'remind': entities = json.loads(wit)['outcomes'][0]['entities'] date = dateutil.parser.parse(entities['time'][0]['value']['from']) text = entities['message'] m = create_reminder(date, text, phone) else: m = "Hmm? Try again please :(" # Send to wit.ai for processing resp = twilio.twiml.Response() resp.message(m) return str(resp) def rec(): print request.form.get('TranscriptionText','') return '' Select the message text in twiliofrom flask import request import requests from ..utils.status import get_status from ..utils.reminders import create_reminder import twilio.twiml import json import dateutil def call(): resp = twilio.twiml.Response() resp.record(timeout=10, transcribe=True, transcribeCallback='http://queri.me/rec', ) return str(resp) def text(): b = request.form.get('Body','') phone = request.form.get('From','') wit = requests.get('https://api.wit.ai/message?v=20140905&q=%s' % b, headers={'Authorization':'Bearer L3VB34V6YTDFO4BRXNDQNAYMVOOF4BHB'}).text intent = json.loads(wit)['outcomes'][0]['intent'] print json.loads(wit) if intent == 'get_status': m = get_status(wit, phone) elif intent == 'remind': entities = json.loads(wit)['outcomes'][0]['entities'] date = dateutil.parser.parse(entities['time'][0]['value']['from']) text = entities['message'][0]['value'] m = create_reminder(date, text, phone) else: m = "Hmm? Try again please :(" # Send to wit.ai for processing resp = twilio.twiml.Response() resp.message(m) return str(resp) def rec(): print request.form.get('TranscriptionText','') return ''
<commit_before>from flask import request import requests from ..utils.status import get_status from ..utils.reminders import create_reminder import twilio.twiml import json import dateutil def call(): resp = twilio.twiml.Response() resp.record(timeout=10, transcribe=True, transcribeCallback='http://queri.me/rec', ) return str(resp) def text(): b = request.form.get('Body','') phone = request.form.get('From','') wit = requests.get('https://api.wit.ai/message?v=20140905&q=%s' % b, headers={'Authorization':'Bearer L3VB34V6YTDFO4BRXNDQNAYMVOOF4BHB'}).text intent = json.loads(wit)['outcomes'][0]['intent'] print json.loads(wit) if intent == 'get_status': m = get_status(wit, phone) elif intent == 'remind': entities = json.loads(wit)['outcomes'][0]['entities'] date = dateutil.parser.parse(entities['time'][0]['value']['from']) text = entities['message'] m = create_reminder(date, text, phone) else: m = "Hmm? Try again please :(" # Send to wit.ai for processing resp = twilio.twiml.Response() resp.message(m) return str(resp) def rec(): print request.form.get('TranscriptionText','') return '' <commit_msg>Select the message text in twilio<commit_after>from flask import request import requests from ..utils.status import get_status from ..utils.reminders import create_reminder import twilio.twiml import json import dateutil def call(): resp = twilio.twiml.Response() resp.record(timeout=10, transcribe=True, transcribeCallback='http://queri.me/rec', ) return str(resp) def text(): b = request.form.get('Body','') phone = request.form.get('From','') wit = requests.get('https://api.wit.ai/message?v=20140905&q=%s' % b, headers={'Authorization':'Bearer L3VB34V6YTDFO4BRXNDQNAYMVOOF4BHB'}).text intent = json.loads(wit)['outcomes'][0]['intent'] print json.loads(wit) if intent == 'get_status': m = get_status(wit, phone) elif intent == 'remind': entities = json.loads(wit)['outcomes'][0]['entities'] date = dateutil.parser.parse(entities['time'][0]['value']['from']) text = entities['message'][0]['value'] m = create_reminder(date, text, phone) else: m = "Hmm? Try again please :(" # Send to wit.ai for processing resp = twilio.twiml.Response() resp.message(m) return str(resp) def rec(): print request.form.get('TranscriptionText','') return ''
c5aedc4264cb8327a6fb86598d615bdf287102fb
osrframework/__init__.py
osrframework/__init__.py
# -*- coding: cp1252 -*- # ################################################################################## # # Copyright 2014-2017 Félix Brezo and Yaiza Rubio (i3visio, [email protected]) # # OSRFramework is free software: you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation, either version 3 of the License, or # (at your option) any later version. # # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program. If not, see <http://www.gnu.org/licenses/>. # ################################################################################## import osrframework.utils.logger # Calling the logger when being imported osrframework.utils.logger.setupLogger(loggerName="osrframework") __version__="0.15.0rc4"
# -*- coding: cp1252 -*- # ################################################################################## # # Copyright 2014-2017 Félix Brezo and Yaiza Rubio (i3visio, [email protected]) # # OSRFramework is free software: you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation, either version 3 of the License, or # (at your option) any later version. # # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program. If not, see <http://www.gnu.org/licenses/>. # ################################################################################## import osrframework.utils.logger # Calling the logger when being imported osrframework.utils.logger.setupLogger(loggerName="osrframework") __version__="0.15.0rc5"
Set release version to 0.15.0rc5
Set release version to 0.15.0rc5
Python
agpl-3.0
i3visio/osrframework
# -*- coding: cp1252 -*- # ################################################################################## # # Copyright 2014-2017 Félix Brezo and Yaiza Rubio (i3visio, [email protected]) # # OSRFramework is free software: you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation, either version 3 of the License, or # (at your option) any later version. # # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program. If not, see <http://www.gnu.org/licenses/>. # ################################################################################## import osrframework.utils.logger # Calling the logger when being imported osrframework.utils.logger.setupLogger(loggerName="osrframework") __version__="0.15.0rc4" Set release version to 0.15.0rc5
# -*- coding: cp1252 -*- # ################################################################################## # # Copyright 2014-2017 Félix Brezo and Yaiza Rubio (i3visio, [email protected]) # # OSRFramework is free software: you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation, either version 3 of the License, or # (at your option) any later version. # # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program. If not, see <http://www.gnu.org/licenses/>. # ################################################################################## import osrframework.utils.logger # Calling the logger when being imported osrframework.utils.logger.setupLogger(loggerName="osrframework") __version__="0.15.0rc5"
<commit_before># -*- coding: cp1252 -*- # ################################################################################## # # Copyright 2014-2017 Félix Brezo and Yaiza Rubio (i3visio, [email protected]) # # OSRFramework is free software: you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation, either version 3 of the License, or # (at your option) any later version. # # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program. If not, see <http://www.gnu.org/licenses/>. # ################################################################################## import osrframework.utils.logger # Calling the logger when being imported osrframework.utils.logger.setupLogger(loggerName="osrframework") __version__="0.15.0rc4" <commit_msg>Set release version to 0.15.0rc5<commit_after>
# -*- coding: cp1252 -*- # ################################################################################## # # Copyright 2014-2017 Félix Brezo and Yaiza Rubio (i3visio, [email protected]) # # OSRFramework is free software: you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation, either version 3 of the License, or # (at your option) any later version. # # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program. If not, see <http://www.gnu.org/licenses/>. # ################################################################################## import osrframework.utils.logger # Calling the logger when being imported osrframework.utils.logger.setupLogger(loggerName="osrframework") __version__="0.15.0rc5"
# -*- coding: cp1252 -*- # ################################################################################## # # Copyright 2014-2017 Félix Brezo and Yaiza Rubio (i3visio, [email protected]) # # OSRFramework is free software: you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation, either version 3 of the License, or # (at your option) any later version. # # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program. If not, see <http://www.gnu.org/licenses/>. # ################################################################################## import osrframework.utils.logger # Calling the logger when being imported osrframework.utils.logger.setupLogger(loggerName="osrframework") __version__="0.15.0rc4" Set release version to 0.15.0rc5# -*- coding: cp1252 -*- # ################################################################################## # # Copyright 2014-2017 Félix Brezo and Yaiza Rubio (i3visio, [email protected]) # # OSRFramework is free software: you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation, either version 3 of the License, or # (at your option) any later version. # # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program. If not, see <http://www.gnu.org/licenses/>. # ################################################################################## import osrframework.utils.logger # Calling the logger when being imported osrframework.utils.logger.setupLogger(loggerName="osrframework") __version__="0.15.0rc5"
<commit_before># -*- coding: cp1252 -*- # ################################################################################## # # Copyright 2014-2017 Félix Brezo and Yaiza Rubio (i3visio, [email protected]) # # OSRFramework is free software: you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation, either version 3 of the License, or # (at your option) any later version. # # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program. If not, see <http://www.gnu.org/licenses/>. # ################################################################################## import osrframework.utils.logger # Calling the logger when being imported osrframework.utils.logger.setupLogger(loggerName="osrframework") __version__="0.15.0rc4" <commit_msg>Set release version to 0.15.0rc5<commit_after># -*- coding: cp1252 -*- # ################################################################################## # # Copyright 2014-2017 Félix Brezo and Yaiza Rubio (i3visio, [email protected]) # # OSRFramework is free software: you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by # the Free Software Foundation, either version 3 of the License, or # (at your option) any later version. # # This program is distributed in the hope that it will be useful, # but WITHOUT ANY WARRANTY; without even the implied warranty of # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the # GNU General Public License for more details. # # You should have received a copy of the GNU General Public License # along with this program. If not, see <http://www.gnu.org/licenses/>. # ################################################################################## import osrframework.utils.logger # Calling the logger when being imported osrframework.utils.logger.setupLogger(loggerName="osrframework") __version__="0.15.0rc5"
506b3399fe20b0267e26a944b49d9ab16d927b31
test.py
test.py
import parser, codegen, compile import sys, os, unittest, subprocess DIR = os.path.dirname(__file__) TESTS_DIR = os.path.join(DIR, 'tests') TESTS = [ 'hello', 'print-int', 'multi-stmt', 'int-add', 'var-hello', ] def run(self, key): fullname = os.path.join(TESTS_DIR, key + '.lng') base = fullname.rsplit('.lng', 1)[0] bin = base + '.test' compile.compile(fullname, bin) out = subprocess.check_output([bin]) if os.path.exists(base + '.out'): expected = open(base + '.out').read() else: expected = '' self.assertEquals(out, expected) def testfunc(key): def do(self): return self._do(key) return do attrs = {'_do': run} for key in TESTS: m = testfunc(key) m.__name__ = 'test_%s' % key attrs[m.__name__] = m LangTests = type('LangTests', (unittest.TestCase,), attrs) def suite(): return unittest.makeSuite(LangTests, 'test') if __name__ == '__main__': if len(sys.argv) > 1: print run(None, sys.argv[1]) else: unittest.main(defaultTest='suite')
import parser, codegen, compile import sys, os, unittest, subprocess DIR = os.path.dirname(__file__) TESTS_DIR = os.path.join(DIR, 'tests') TESTS = [ 'hello', 'print-int', 'multi-stmt', 'int-add', 'var-hello', 'int-var', ] def run(self, key): fullname = os.path.join(TESTS_DIR, key + '.lng') base = fullname.rsplit('.lng', 1)[0] bin = base + '.test' compile.compile(fullname, bin) out = subprocess.check_output([bin]) if os.path.exists(base + '.out'): expected = open(base + '.out').read() else: expected = '' self.assertEquals(out, expected) def testfunc(key): def do(self): return self._do(key) return do attrs = {'_do': run} for key in TESTS: m = testfunc(key) m.__name__ = 'test_%s' % key attrs[m.__name__] = m LangTests = type('LangTests', (unittest.TestCase,), attrs) def suite(): return unittest.makeSuite(LangTests, 'test') if __name__ == '__main__': if len(sys.argv) > 1: print run(None, sys.argv[1]) else: unittest.main(defaultTest='suite')
Verify that integer variables also work.
Verify that integer variables also work.
Python
mit
djc/runa,djc/runa,djc/runa,djc/runa
import parser, codegen, compile import sys, os, unittest, subprocess DIR = os.path.dirname(__file__) TESTS_DIR = os.path.join(DIR, 'tests') TESTS = [ 'hello', 'print-int', 'multi-stmt', 'int-add', 'var-hello', ] def run(self, key): fullname = os.path.join(TESTS_DIR, key + '.lng') base = fullname.rsplit('.lng', 1)[0] bin = base + '.test' compile.compile(fullname, bin) out = subprocess.check_output([bin]) if os.path.exists(base + '.out'): expected = open(base + '.out').read() else: expected = '' self.assertEquals(out, expected) def testfunc(key): def do(self): return self._do(key) return do attrs = {'_do': run} for key in TESTS: m = testfunc(key) m.__name__ = 'test_%s' % key attrs[m.__name__] = m LangTests = type('LangTests', (unittest.TestCase,), attrs) def suite(): return unittest.makeSuite(LangTests, 'test') if __name__ == '__main__': if len(sys.argv) > 1: print run(None, sys.argv[1]) else: unittest.main(defaultTest='suite') Verify that integer variables also work.
import parser, codegen, compile import sys, os, unittest, subprocess DIR = os.path.dirname(__file__) TESTS_DIR = os.path.join(DIR, 'tests') TESTS = [ 'hello', 'print-int', 'multi-stmt', 'int-add', 'var-hello', 'int-var', ] def run(self, key): fullname = os.path.join(TESTS_DIR, key + '.lng') base = fullname.rsplit('.lng', 1)[0] bin = base + '.test' compile.compile(fullname, bin) out = subprocess.check_output([bin]) if os.path.exists(base + '.out'): expected = open(base + '.out').read() else: expected = '' self.assertEquals(out, expected) def testfunc(key): def do(self): return self._do(key) return do attrs = {'_do': run} for key in TESTS: m = testfunc(key) m.__name__ = 'test_%s' % key attrs[m.__name__] = m LangTests = type('LangTests', (unittest.TestCase,), attrs) def suite(): return unittest.makeSuite(LangTests, 'test') if __name__ == '__main__': if len(sys.argv) > 1: print run(None, sys.argv[1]) else: unittest.main(defaultTest='suite')
<commit_before>import parser, codegen, compile import sys, os, unittest, subprocess DIR = os.path.dirname(__file__) TESTS_DIR = os.path.join(DIR, 'tests') TESTS = [ 'hello', 'print-int', 'multi-stmt', 'int-add', 'var-hello', ] def run(self, key): fullname = os.path.join(TESTS_DIR, key + '.lng') base = fullname.rsplit('.lng', 1)[0] bin = base + '.test' compile.compile(fullname, bin) out = subprocess.check_output([bin]) if os.path.exists(base + '.out'): expected = open(base + '.out').read() else: expected = '' self.assertEquals(out, expected) def testfunc(key): def do(self): return self._do(key) return do attrs = {'_do': run} for key in TESTS: m = testfunc(key) m.__name__ = 'test_%s' % key attrs[m.__name__] = m LangTests = type('LangTests', (unittest.TestCase,), attrs) def suite(): return unittest.makeSuite(LangTests, 'test') if __name__ == '__main__': if len(sys.argv) > 1: print run(None, sys.argv[1]) else: unittest.main(defaultTest='suite') <commit_msg>Verify that integer variables also work.<commit_after>
import parser, codegen, compile import sys, os, unittest, subprocess DIR = os.path.dirname(__file__) TESTS_DIR = os.path.join(DIR, 'tests') TESTS = [ 'hello', 'print-int', 'multi-stmt', 'int-add', 'var-hello', 'int-var', ] def run(self, key): fullname = os.path.join(TESTS_DIR, key + '.lng') base = fullname.rsplit('.lng', 1)[0] bin = base + '.test' compile.compile(fullname, bin) out = subprocess.check_output([bin]) if os.path.exists(base + '.out'): expected = open(base + '.out').read() else: expected = '' self.assertEquals(out, expected) def testfunc(key): def do(self): return self._do(key) return do attrs = {'_do': run} for key in TESTS: m = testfunc(key) m.__name__ = 'test_%s' % key attrs[m.__name__] = m LangTests = type('LangTests', (unittest.TestCase,), attrs) def suite(): return unittest.makeSuite(LangTests, 'test') if __name__ == '__main__': if len(sys.argv) > 1: print run(None, sys.argv[1]) else: unittest.main(defaultTest='suite')
import parser, codegen, compile import sys, os, unittest, subprocess DIR = os.path.dirname(__file__) TESTS_DIR = os.path.join(DIR, 'tests') TESTS = [ 'hello', 'print-int', 'multi-stmt', 'int-add', 'var-hello', ] def run(self, key): fullname = os.path.join(TESTS_DIR, key + '.lng') base = fullname.rsplit('.lng', 1)[0] bin = base + '.test' compile.compile(fullname, bin) out = subprocess.check_output([bin]) if os.path.exists(base + '.out'): expected = open(base + '.out').read() else: expected = '' self.assertEquals(out, expected) def testfunc(key): def do(self): return self._do(key) return do attrs = {'_do': run} for key in TESTS: m = testfunc(key) m.__name__ = 'test_%s' % key attrs[m.__name__] = m LangTests = type('LangTests', (unittest.TestCase,), attrs) def suite(): return unittest.makeSuite(LangTests, 'test') if __name__ == '__main__': if len(sys.argv) > 1: print run(None, sys.argv[1]) else: unittest.main(defaultTest='suite') Verify that integer variables also work.import parser, codegen, compile import sys, os, unittest, subprocess DIR = os.path.dirname(__file__) TESTS_DIR = os.path.join(DIR, 'tests') TESTS = [ 'hello', 'print-int', 'multi-stmt', 'int-add', 'var-hello', 'int-var', ] def run(self, key): fullname = os.path.join(TESTS_DIR, key + '.lng') base = fullname.rsplit('.lng', 1)[0] bin = base + '.test' compile.compile(fullname, bin) out = subprocess.check_output([bin]) if os.path.exists(base + '.out'): expected = open(base + '.out').read() else: expected = '' self.assertEquals(out, expected) def testfunc(key): def do(self): return self._do(key) return do attrs = {'_do': run} for key in TESTS: m = testfunc(key) m.__name__ = 'test_%s' % key attrs[m.__name__] = m LangTests = type('LangTests', (unittest.TestCase,), attrs) def suite(): return unittest.makeSuite(LangTests, 'test') if __name__ == '__main__': if len(sys.argv) > 1: print run(None, sys.argv[1]) else: unittest.main(defaultTest='suite')
<commit_before>import parser, codegen, compile import sys, os, unittest, subprocess DIR = os.path.dirname(__file__) TESTS_DIR = os.path.join(DIR, 'tests') TESTS = [ 'hello', 'print-int', 'multi-stmt', 'int-add', 'var-hello', ] def run(self, key): fullname = os.path.join(TESTS_DIR, key + '.lng') base = fullname.rsplit('.lng', 1)[0] bin = base + '.test' compile.compile(fullname, bin) out = subprocess.check_output([bin]) if os.path.exists(base + '.out'): expected = open(base + '.out').read() else: expected = '' self.assertEquals(out, expected) def testfunc(key): def do(self): return self._do(key) return do attrs = {'_do': run} for key in TESTS: m = testfunc(key) m.__name__ = 'test_%s' % key attrs[m.__name__] = m LangTests = type('LangTests', (unittest.TestCase,), attrs) def suite(): return unittest.makeSuite(LangTests, 'test') if __name__ == '__main__': if len(sys.argv) > 1: print run(None, sys.argv[1]) else: unittest.main(defaultTest='suite') <commit_msg>Verify that integer variables also work.<commit_after>import parser, codegen, compile import sys, os, unittest, subprocess DIR = os.path.dirname(__file__) TESTS_DIR = os.path.join(DIR, 'tests') TESTS = [ 'hello', 'print-int', 'multi-stmt', 'int-add', 'var-hello', 'int-var', ] def run(self, key): fullname = os.path.join(TESTS_DIR, key + '.lng') base = fullname.rsplit('.lng', 1)[0] bin = base + '.test' compile.compile(fullname, bin) out = subprocess.check_output([bin]) if os.path.exists(base + '.out'): expected = open(base + '.out').read() else: expected = '' self.assertEquals(out, expected) def testfunc(key): def do(self): return self._do(key) return do attrs = {'_do': run} for key in TESTS: m = testfunc(key) m.__name__ = 'test_%s' % key attrs[m.__name__] = m LangTests = type('LangTests', (unittest.TestCase,), attrs) def suite(): return unittest.makeSuite(LangTests, 'test') if __name__ == '__main__': if len(sys.argv) > 1: print run(None, sys.argv[1]) else: unittest.main(defaultTest='suite')
a8ed783aff7a725260904d84e36e1f4ac7ed91b3
example_slack.py
example_slack.py
#!/usr/bin/env python """Sets a luxafor flag based on status.""" import luxafor import os import time from slackclient import SlackClient slack_token = os.environ["SLACK_API_TOKEN"] sc = SlackClient(slack_token) API = luxafor.API() while (True): presence = sc.api_call("dnd.info") if presence['snooze_enabled']: API.mode_colour(luxafor.COLOUR_RED) else: API.mode_colour(luxafor.COLOUR_GREEN) time.sleep(1) # make sure we don't flood slack
#!/usr/bin/env python """Sets a luxafor flag based on status.""" import luxafor import os import time from slackclient import SlackClient slack_token = os.environ["SLACK_API_TOKEN"] slack_client = SlackClient(slack_token) lux = luxafor.API() snooze_remaining = -1 # Countdown timer user_id = 'U024G0M2L' if slack_client.rtm_connect(): while True: try: for event in slack_client.rtm_read(): if event['type'] == 'dnd_updated' and event['user'] == user_id: if event['dnd_status']['snooze_enabled'] is True: lux.mode_colour(luxafor.COLOUR_RED) snooze_remaining = event['dnd_status']['snooze_remaining'] else: lux.mode_colour(luxafor.COLOUR_GREEN) except KeyError: pass if snooze_remaining >= 1: snooze_remaining -= 1 if snooze_remaining == 0 or snooze_remaining == -1: lux.mode_colour(luxafor.COLOUR_GREEN) snooze_remaining = -1 time.sleep(1) else: print("Connection Failed, invalid token?")
Switch to use RTM protocol
Switch to use RTM protocol There isn’t an RTM event for ‘stops being DND’ so I’ve added a simple countdown loop, it loses about a second or two, but it works. Happy to have feedback on the loops / logic, feels like it could be sharper.
Python
mit
blancltd/luxafor
#!/usr/bin/env python """Sets a luxafor flag based on status.""" import luxafor import os import time from slackclient import SlackClient slack_token = os.environ["SLACK_API_TOKEN"] sc = SlackClient(slack_token) API = luxafor.API() while (True): presence = sc.api_call("dnd.info") if presence['snooze_enabled']: API.mode_colour(luxafor.COLOUR_RED) else: API.mode_colour(luxafor.COLOUR_GREEN) time.sleep(1) # make sure we don't flood slack Switch to use RTM protocol There isn’t an RTM event for ‘stops being DND’ so I’ve added a simple countdown loop, it loses about a second or two, but it works. Happy to have feedback on the loops / logic, feels like it could be sharper.
#!/usr/bin/env python """Sets a luxafor flag based on status.""" import luxafor import os import time from slackclient import SlackClient slack_token = os.environ["SLACK_API_TOKEN"] slack_client = SlackClient(slack_token) lux = luxafor.API() snooze_remaining = -1 # Countdown timer user_id = 'U024G0M2L' if slack_client.rtm_connect(): while True: try: for event in slack_client.rtm_read(): if event['type'] == 'dnd_updated' and event['user'] == user_id: if event['dnd_status']['snooze_enabled'] is True: lux.mode_colour(luxafor.COLOUR_RED) snooze_remaining = event['dnd_status']['snooze_remaining'] else: lux.mode_colour(luxafor.COLOUR_GREEN) except KeyError: pass if snooze_remaining >= 1: snooze_remaining -= 1 if snooze_remaining == 0 or snooze_remaining == -1: lux.mode_colour(luxafor.COLOUR_GREEN) snooze_remaining = -1 time.sleep(1) else: print("Connection Failed, invalid token?")
<commit_before>#!/usr/bin/env python """Sets a luxafor flag based on status.""" import luxafor import os import time from slackclient import SlackClient slack_token = os.environ["SLACK_API_TOKEN"] sc = SlackClient(slack_token) API = luxafor.API() while (True): presence = sc.api_call("dnd.info") if presence['snooze_enabled']: API.mode_colour(luxafor.COLOUR_RED) else: API.mode_colour(luxafor.COLOUR_GREEN) time.sleep(1) # make sure we don't flood slack <commit_msg>Switch to use RTM protocol There isn’t an RTM event for ‘stops being DND’ so I’ve added a simple countdown loop, it loses about a second or two, but it works. Happy to have feedback on the loops / logic, feels like it could be sharper.<commit_after>
#!/usr/bin/env python """Sets a luxafor flag based on status.""" import luxafor import os import time from slackclient import SlackClient slack_token = os.environ["SLACK_API_TOKEN"] slack_client = SlackClient(slack_token) lux = luxafor.API() snooze_remaining = -1 # Countdown timer user_id = 'U024G0M2L' if slack_client.rtm_connect(): while True: try: for event in slack_client.rtm_read(): if event['type'] == 'dnd_updated' and event['user'] == user_id: if event['dnd_status']['snooze_enabled'] is True: lux.mode_colour(luxafor.COLOUR_RED) snooze_remaining = event['dnd_status']['snooze_remaining'] else: lux.mode_colour(luxafor.COLOUR_GREEN) except KeyError: pass if snooze_remaining >= 1: snooze_remaining -= 1 if snooze_remaining == 0 or snooze_remaining == -1: lux.mode_colour(luxafor.COLOUR_GREEN) snooze_remaining = -1 time.sleep(1) else: print("Connection Failed, invalid token?")
#!/usr/bin/env python """Sets a luxafor flag based on status.""" import luxafor import os import time from slackclient import SlackClient slack_token = os.environ["SLACK_API_TOKEN"] sc = SlackClient(slack_token) API = luxafor.API() while (True): presence = sc.api_call("dnd.info") if presence['snooze_enabled']: API.mode_colour(luxafor.COLOUR_RED) else: API.mode_colour(luxafor.COLOUR_GREEN) time.sleep(1) # make sure we don't flood slack Switch to use RTM protocol There isn’t an RTM event for ‘stops being DND’ so I’ve added a simple countdown loop, it loses about a second or two, but it works. Happy to have feedback on the loops / logic, feels like it could be sharper.#!/usr/bin/env python """Sets a luxafor flag based on status.""" import luxafor import os import time from slackclient import SlackClient slack_token = os.environ["SLACK_API_TOKEN"] slack_client = SlackClient(slack_token) lux = luxafor.API() snooze_remaining = -1 # Countdown timer user_id = 'U024G0M2L' if slack_client.rtm_connect(): while True: try: for event in slack_client.rtm_read(): if event['type'] == 'dnd_updated' and event['user'] == user_id: if event['dnd_status']['snooze_enabled'] is True: lux.mode_colour(luxafor.COLOUR_RED) snooze_remaining = event['dnd_status']['snooze_remaining'] else: lux.mode_colour(luxafor.COLOUR_GREEN) except KeyError: pass if snooze_remaining >= 1: snooze_remaining -= 1 if snooze_remaining == 0 or snooze_remaining == -1: lux.mode_colour(luxafor.COLOUR_GREEN) snooze_remaining = -1 time.sleep(1) else: print("Connection Failed, invalid token?")
<commit_before>#!/usr/bin/env python """Sets a luxafor flag based on status.""" import luxafor import os import time from slackclient import SlackClient slack_token = os.environ["SLACK_API_TOKEN"] sc = SlackClient(slack_token) API = luxafor.API() while (True): presence = sc.api_call("dnd.info") if presence['snooze_enabled']: API.mode_colour(luxafor.COLOUR_RED) else: API.mode_colour(luxafor.COLOUR_GREEN) time.sleep(1) # make sure we don't flood slack <commit_msg>Switch to use RTM protocol There isn’t an RTM event for ‘stops being DND’ so I’ve added a simple countdown loop, it loses about a second or two, but it works. Happy to have feedback on the loops / logic, feels like it could be sharper.<commit_after>#!/usr/bin/env python """Sets a luxafor flag based on status.""" import luxafor import os import time from slackclient import SlackClient slack_token = os.environ["SLACK_API_TOKEN"] slack_client = SlackClient(slack_token) lux = luxafor.API() snooze_remaining = -1 # Countdown timer user_id = 'U024G0M2L' if slack_client.rtm_connect(): while True: try: for event in slack_client.rtm_read(): if event['type'] == 'dnd_updated' and event['user'] == user_id: if event['dnd_status']['snooze_enabled'] is True: lux.mode_colour(luxafor.COLOUR_RED) snooze_remaining = event['dnd_status']['snooze_remaining'] else: lux.mode_colour(luxafor.COLOUR_GREEN) except KeyError: pass if snooze_remaining >= 1: snooze_remaining -= 1 if snooze_remaining == 0 or snooze_remaining == -1: lux.mode_colour(luxafor.COLOUR_GREEN) snooze_remaining = -1 time.sleep(1) else: print("Connection Failed, invalid token?")
a452adfb297ff40ec3db71108681829769b1fba4
pyface/tasks/enaml_editor.py
pyface/tasks/enaml_editor.py
# Enthought library imports. from traits.api import Instance, on_trait_change from enaml.components.constraints_widget import ConstraintsWidget # local imports from pyface.tasks.editor import Editor class EnamlEditor(Editor): """ Create an Editor for Enaml Components. """ #### EnamlEditor interface ############################################## component = Instance(ConstraintsWidget) def create_component(self): raise NotImplementedError ########################################################################### # 'IEditor' interface. ########################################################################### def create(self, parent): self.component = self.create_component() self.component.setup(parent=parent) self.control = self.component.toolkit_widget self.component.on_trait_change(self.size_hint_changed, 'size_hint_updated') def destroy(self): self.control = None self.component.destroy()
# Enthought library imports. from traits.api import Instance, on_trait_change from enaml.components.constraints_widget import ConstraintsWidget # local imports from pyface.tasks.editor import Editor class EnamlEditor(Editor): """ Create an Editor for Enaml Components. """ #### EnamlEditor interface ############################################## component = Instance(ConstraintsWidget) def create_component(self): raise NotImplementedError ########################################################################### # 'IEditor' interface. ########################################################################### def create(self, parent): self.component = self.create_component() self.component.setup(parent=parent) self.control = self.component.toolkit_widget def destroy(self): self.control = None self.component.destroy()
Remove call of unimplemented method.
BUG: Remove call of unimplemented method.
Python
bsd-3-clause
brett-patterson/pyface,pankajp/pyface,geggo/pyface,geggo/pyface
# Enthought library imports. from traits.api import Instance, on_trait_change from enaml.components.constraints_widget import ConstraintsWidget # local imports from pyface.tasks.editor import Editor class EnamlEditor(Editor): """ Create an Editor for Enaml Components. """ #### EnamlEditor interface ############################################## component = Instance(ConstraintsWidget) def create_component(self): raise NotImplementedError ########################################################################### # 'IEditor' interface. ########################################################################### def create(self, parent): self.component = self.create_component() self.component.setup(parent=parent) self.control = self.component.toolkit_widget self.component.on_trait_change(self.size_hint_changed, 'size_hint_updated') def destroy(self): self.control = None self.component.destroy() BUG: Remove call of unimplemented method.
# Enthought library imports. from traits.api import Instance, on_trait_change from enaml.components.constraints_widget import ConstraintsWidget # local imports from pyface.tasks.editor import Editor class EnamlEditor(Editor): """ Create an Editor for Enaml Components. """ #### EnamlEditor interface ############################################## component = Instance(ConstraintsWidget) def create_component(self): raise NotImplementedError ########################################################################### # 'IEditor' interface. ########################################################################### def create(self, parent): self.component = self.create_component() self.component.setup(parent=parent) self.control = self.component.toolkit_widget def destroy(self): self.control = None self.component.destroy()
<commit_before># Enthought library imports. from traits.api import Instance, on_trait_change from enaml.components.constraints_widget import ConstraintsWidget # local imports from pyface.tasks.editor import Editor class EnamlEditor(Editor): """ Create an Editor for Enaml Components. """ #### EnamlEditor interface ############################################## component = Instance(ConstraintsWidget) def create_component(self): raise NotImplementedError ########################################################################### # 'IEditor' interface. ########################################################################### def create(self, parent): self.component = self.create_component() self.component.setup(parent=parent) self.control = self.component.toolkit_widget self.component.on_trait_change(self.size_hint_changed, 'size_hint_updated') def destroy(self): self.control = None self.component.destroy() <commit_msg>BUG: Remove call of unimplemented method.<commit_after>
# Enthought library imports. from traits.api import Instance, on_trait_change from enaml.components.constraints_widget import ConstraintsWidget # local imports from pyface.tasks.editor import Editor class EnamlEditor(Editor): """ Create an Editor for Enaml Components. """ #### EnamlEditor interface ############################################## component = Instance(ConstraintsWidget) def create_component(self): raise NotImplementedError ########################################################################### # 'IEditor' interface. ########################################################################### def create(self, parent): self.component = self.create_component() self.component.setup(parent=parent) self.control = self.component.toolkit_widget def destroy(self): self.control = None self.component.destroy()
# Enthought library imports. from traits.api import Instance, on_trait_change from enaml.components.constraints_widget import ConstraintsWidget # local imports from pyface.tasks.editor import Editor class EnamlEditor(Editor): """ Create an Editor for Enaml Components. """ #### EnamlEditor interface ############################################## component = Instance(ConstraintsWidget) def create_component(self): raise NotImplementedError ########################################################################### # 'IEditor' interface. ########################################################################### def create(self, parent): self.component = self.create_component() self.component.setup(parent=parent) self.control = self.component.toolkit_widget self.component.on_trait_change(self.size_hint_changed, 'size_hint_updated') def destroy(self): self.control = None self.component.destroy() BUG: Remove call of unimplemented method.# Enthought library imports. from traits.api import Instance, on_trait_change from enaml.components.constraints_widget import ConstraintsWidget # local imports from pyface.tasks.editor import Editor class EnamlEditor(Editor): """ Create an Editor for Enaml Components. """ #### EnamlEditor interface ############################################## component = Instance(ConstraintsWidget) def create_component(self): raise NotImplementedError ########################################################################### # 'IEditor' interface. ########################################################################### def create(self, parent): self.component = self.create_component() self.component.setup(parent=parent) self.control = self.component.toolkit_widget def destroy(self): self.control = None self.component.destroy()
<commit_before># Enthought library imports. from traits.api import Instance, on_trait_change from enaml.components.constraints_widget import ConstraintsWidget # local imports from pyface.tasks.editor import Editor class EnamlEditor(Editor): """ Create an Editor for Enaml Components. """ #### EnamlEditor interface ############################################## component = Instance(ConstraintsWidget) def create_component(self): raise NotImplementedError ########################################################################### # 'IEditor' interface. ########################################################################### def create(self, parent): self.component = self.create_component() self.component.setup(parent=parent) self.control = self.component.toolkit_widget self.component.on_trait_change(self.size_hint_changed, 'size_hint_updated') def destroy(self): self.control = None self.component.destroy() <commit_msg>BUG: Remove call of unimplemented method.<commit_after># Enthought library imports. from traits.api import Instance, on_trait_change from enaml.components.constraints_widget import ConstraintsWidget # local imports from pyface.tasks.editor import Editor class EnamlEditor(Editor): """ Create an Editor for Enaml Components. """ #### EnamlEditor interface ############################################## component = Instance(ConstraintsWidget) def create_component(self): raise NotImplementedError ########################################################################### # 'IEditor' interface. ########################################################################### def create(self, parent): self.component = self.create_component() self.component.setup(parent=parent) self.control = self.component.toolkit_widget def destroy(self): self.control = None self.component.destroy()
938fc30d5a0067bb80525c8db450e064c29597e5
tx_salaries/managers.py
tx_salaries/managers.py
from django.db import models class DenormalizeManagerMixin(object): def update_cohort(self, cohort, **kwargs): stats, created = self.get_or_create(**kwargs) stats.highest_paid = cohort.order_by('-compensation')[0] stats.lowest_paid = cohort.order_by('compensation')[0] stats.save() class OrganizationStatsManager(models.Manager): use_for_related_manager = True def denormalize(self, obj): Employee = obj._meta.concrete_model use_children = False organization = obj.position.organization # TODO: Allow organization to break and say it is top-level # Example: El Paso County Sheriff's Department instead # of going all the way to El Paso County. if organization.parent: use_children = True organization = organization.parent if use_children: kwargs = { 'parent': None, 'children__members__employee': obj, } else: kwargs = {'members__employee': obj, } cohort = Employee.objects.filter(**kwargs) self.update_cohort(cohort, organization=organization) class PositionStatsManager(models.Manager): use_for_related_manager = True def denormalize(self, obj): Employee = obj._meta.concrete_model position_cohort = Employee.objects.filter( position__organization=obj.position.organization) self.update_cohort(position_cohort, position=obj.position.post)
from django.db import models class DenormalizeManagerMixin(object): def update_cohort(self, cohort, **kwargs): stats, created = self.get_or_create(**kwargs) stats.highest_paid = cohort.order_by('-compensation')[0] stats.lowest_paid = cohort.order_by('compensation')[0] stats.save() class OrganizationStatsManager(DenormalizeManagerMixin, models.Manager): use_for_related_manager = True def denormalize(self, obj): Employee = obj._meta.concrete_model use_children = False organization = obj.position.organization # TODO: Allow organization to break and say it is top-level # Example: El Paso County Sheriff's Department instead # of going all the way to El Paso County. if organization.parent: use_children = True organization = organization.parent if use_children: kwargs = {'position__organization__parent': organization, } else: kwargs = {'position__organization': organization, } cohort = Employee.objects.filter(**kwargs) self.update_cohort(cohort, organization=organization) class PositionStatsManager(DenormalizeManagerMixin, models.Manager): use_for_related_manager = True def denormalize(self, obj): Employee = obj._meta.concrete_model position_cohort = Employee.objects.filter( position__organization=obj.position.organization) self.update_cohort(position_cohort, position=obj.position.post)
Fix this code so it works
Fix this code so it works
Python
apache-2.0
texastribune/tx_salaries,texastribune/tx_salaries
from django.db import models class DenormalizeManagerMixin(object): def update_cohort(self, cohort, **kwargs): stats, created = self.get_or_create(**kwargs) stats.highest_paid = cohort.order_by('-compensation')[0] stats.lowest_paid = cohort.order_by('compensation')[0] stats.save() class OrganizationStatsManager(models.Manager): use_for_related_manager = True def denormalize(self, obj): Employee = obj._meta.concrete_model use_children = False organization = obj.position.organization # TODO: Allow organization to break and say it is top-level # Example: El Paso County Sheriff's Department instead # of going all the way to El Paso County. if organization.parent: use_children = True organization = organization.parent if use_children: kwargs = { 'parent': None, 'children__members__employee': obj, } else: kwargs = {'members__employee': obj, } cohort = Employee.objects.filter(**kwargs) self.update_cohort(cohort, organization=organization) class PositionStatsManager(models.Manager): use_for_related_manager = True def denormalize(self, obj): Employee = obj._meta.concrete_model position_cohort = Employee.objects.filter( position__organization=obj.position.organization) self.update_cohort(position_cohort, position=obj.position.post) Fix this code so it works
from django.db import models class DenormalizeManagerMixin(object): def update_cohort(self, cohort, **kwargs): stats, created = self.get_or_create(**kwargs) stats.highest_paid = cohort.order_by('-compensation')[0] stats.lowest_paid = cohort.order_by('compensation')[0] stats.save() class OrganizationStatsManager(DenormalizeManagerMixin, models.Manager): use_for_related_manager = True def denormalize(self, obj): Employee = obj._meta.concrete_model use_children = False organization = obj.position.organization # TODO: Allow organization to break and say it is top-level # Example: El Paso County Sheriff's Department instead # of going all the way to El Paso County. if organization.parent: use_children = True organization = organization.parent if use_children: kwargs = {'position__organization__parent': organization, } else: kwargs = {'position__organization': organization, } cohort = Employee.objects.filter(**kwargs) self.update_cohort(cohort, organization=organization) class PositionStatsManager(DenormalizeManagerMixin, models.Manager): use_for_related_manager = True def denormalize(self, obj): Employee = obj._meta.concrete_model position_cohort = Employee.objects.filter( position__organization=obj.position.organization) self.update_cohort(position_cohort, position=obj.position.post)
<commit_before>from django.db import models class DenormalizeManagerMixin(object): def update_cohort(self, cohort, **kwargs): stats, created = self.get_or_create(**kwargs) stats.highest_paid = cohort.order_by('-compensation')[0] stats.lowest_paid = cohort.order_by('compensation')[0] stats.save() class OrganizationStatsManager(models.Manager): use_for_related_manager = True def denormalize(self, obj): Employee = obj._meta.concrete_model use_children = False organization = obj.position.organization # TODO: Allow organization to break and say it is top-level # Example: El Paso County Sheriff's Department instead # of going all the way to El Paso County. if organization.parent: use_children = True organization = organization.parent if use_children: kwargs = { 'parent': None, 'children__members__employee': obj, } else: kwargs = {'members__employee': obj, } cohort = Employee.objects.filter(**kwargs) self.update_cohort(cohort, organization=organization) class PositionStatsManager(models.Manager): use_for_related_manager = True def denormalize(self, obj): Employee = obj._meta.concrete_model position_cohort = Employee.objects.filter( position__organization=obj.position.organization) self.update_cohort(position_cohort, position=obj.position.post) <commit_msg>Fix this code so it works<commit_after>
from django.db import models class DenormalizeManagerMixin(object): def update_cohort(self, cohort, **kwargs): stats, created = self.get_or_create(**kwargs) stats.highest_paid = cohort.order_by('-compensation')[0] stats.lowest_paid = cohort.order_by('compensation')[0] stats.save() class OrganizationStatsManager(DenormalizeManagerMixin, models.Manager): use_for_related_manager = True def denormalize(self, obj): Employee = obj._meta.concrete_model use_children = False organization = obj.position.organization # TODO: Allow organization to break and say it is top-level # Example: El Paso County Sheriff's Department instead # of going all the way to El Paso County. if organization.parent: use_children = True organization = organization.parent if use_children: kwargs = {'position__organization__parent': organization, } else: kwargs = {'position__organization': organization, } cohort = Employee.objects.filter(**kwargs) self.update_cohort(cohort, organization=organization) class PositionStatsManager(DenormalizeManagerMixin, models.Manager): use_for_related_manager = True def denormalize(self, obj): Employee = obj._meta.concrete_model position_cohort = Employee.objects.filter( position__organization=obj.position.organization) self.update_cohort(position_cohort, position=obj.position.post)
from django.db import models class DenormalizeManagerMixin(object): def update_cohort(self, cohort, **kwargs): stats, created = self.get_or_create(**kwargs) stats.highest_paid = cohort.order_by('-compensation')[0] stats.lowest_paid = cohort.order_by('compensation')[0] stats.save() class OrganizationStatsManager(models.Manager): use_for_related_manager = True def denormalize(self, obj): Employee = obj._meta.concrete_model use_children = False organization = obj.position.organization # TODO: Allow organization to break and say it is top-level # Example: El Paso County Sheriff's Department instead # of going all the way to El Paso County. if organization.parent: use_children = True organization = organization.parent if use_children: kwargs = { 'parent': None, 'children__members__employee': obj, } else: kwargs = {'members__employee': obj, } cohort = Employee.objects.filter(**kwargs) self.update_cohort(cohort, organization=organization) class PositionStatsManager(models.Manager): use_for_related_manager = True def denormalize(self, obj): Employee = obj._meta.concrete_model position_cohort = Employee.objects.filter( position__organization=obj.position.organization) self.update_cohort(position_cohort, position=obj.position.post) Fix this code so it worksfrom django.db import models class DenormalizeManagerMixin(object): def update_cohort(self, cohort, **kwargs): stats, created = self.get_or_create(**kwargs) stats.highest_paid = cohort.order_by('-compensation')[0] stats.lowest_paid = cohort.order_by('compensation')[0] stats.save() class OrganizationStatsManager(DenormalizeManagerMixin, models.Manager): use_for_related_manager = True def denormalize(self, obj): Employee = obj._meta.concrete_model use_children = False organization = obj.position.organization # TODO: Allow organization to break and say it is top-level # Example: El Paso County Sheriff's Department instead # of going all the way to El Paso County. if organization.parent: use_children = True organization = organization.parent if use_children: kwargs = {'position__organization__parent': organization, } else: kwargs = {'position__organization': organization, } cohort = Employee.objects.filter(**kwargs) self.update_cohort(cohort, organization=organization) class PositionStatsManager(DenormalizeManagerMixin, models.Manager): use_for_related_manager = True def denormalize(self, obj): Employee = obj._meta.concrete_model position_cohort = Employee.objects.filter( position__organization=obj.position.organization) self.update_cohort(position_cohort, position=obj.position.post)
<commit_before>from django.db import models class DenormalizeManagerMixin(object): def update_cohort(self, cohort, **kwargs): stats, created = self.get_or_create(**kwargs) stats.highest_paid = cohort.order_by('-compensation')[0] stats.lowest_paid = cohort.order_by('compensation')[0] stats.save() class OrganizationStatsManager(models.Manager): use_for_related_manager = True def denormalize(self, obj): Employee = obj._meta.concrete_model use_children = False organization = obj.position.organization # TODO: Allow organization to break and say it is top-level # Example: El Paso County Sheriff's Department instead # of going all the way to El Paso County. if organization.parent: use_children = True organization = organization.parent if use_children: kwargs = { 'parent': None, 'children__members__employee': obj, } else: kwargs = {'members__employee': obj, } cohort = Employee.objects.filter(**kwargs) self.update_cohort(cohort, organization=organization) class PositionStatsManager(models.Manager): use_for_related_manager = True def denormalize(self, obj): Employee = obj._meta.concrete_model position_cohort = Employee.objects.filter( position__organization=obj.position.organization) self.update_cohort(position_cohort, position=obj.position.post) <commit_msg>Fix this code so it works<commit_after>from django.db import models class DenormalizeManagerMixin(object): def update_cohort(self, cohort, **kwargs): stats, created = self.get_or_create(**kwargs) stats.highest_paid = cohort.order_by('-compensation')[0] stats.lowest_paid = cohort.order_by('compensation')[0] stats.save() class OrganizationStatsManager(DenormalizeManagerMixin, models.Manager): use_for_related_manager = True def denormalize(self, obj): Employee = obj._meta.concrete_model use_children = False organization = obj.position.organization # TODO: Allow organization to break and say it is top-level # Example: El Paso County Sheriff's Department instead # of going all the way to El Paso County. if organization.parent: use_children = True organization = organization.parent if use_children: kwargs = {'position__organization__parent': organization, } else: kwargs = {'position__organization': organization, } cohort = Employee.objects.filter(**kwargs) self.update_cohort(cohort, organization=organization) class PositionStatsManager(DenormalizeManagerMixin, models.Manager): use_for_related_manager = True def denormalize(self, obj): Employee = obj._meta.concrete_model position_cohort = Employee.objects.filter( position__organization=obj.position.organization) self.update_cohort(position_cohort, position=obj.position.post)
f9cb73670966d7cb3ade12056c92c479404cbb07
pythran/tests/test_cython.py
pythran/tests/test_cython.py
import os import unittest class TestCython(unittest.TestCase): pass def add_test(name, runner, target): setattr(TestCython, "test_" + name, lambda s: runner(s, target)) try: import Cython import glob import sys targets = glob.glob(os.path.join(os.path.dirname(__file__), "cython", "setup_*.py")) sys.path.append(os.path.join(os.path.dirname(__file__), "cython")) for target in targets: def runner(self, target): cwd = os.getcwd() try: os.chdir(os.path.dirname(target)) exec(open(os.path.basename(target)).read()) except: raise finally: os.chdir(cwd) name, _ = os.path.splitext(os.path.basename(target)) add_test(name, runner, target) except ImportError: pass
import os import unittest class TestCython(unittest.TestCase): pass # Needs to wait unil cython supports pythran new builtins naming #def add_test(name, runner, target): # setattr(TestCython, "test_" + name, lambda s: runner(s, target)) # #try: # import Cython # import glob # import sys # targets = glob.glob(os.path.join(os.path.dirname(__file__), "cython", "setup_*.py")) # sys.path.append(os.path.join(os.path.dirname(__file__), "cython")) # # for target in targets: # def runner(self, target): # cwd = os.getcwd() # try: # os.chdir(os.path.dirname(target)) # exec(open(os.path.basename(target)).read()) # except: # raise # finally: # os.chdir(cwd) # name, _ = os.path.splitext(os.path.basename(target)) # add_test(name, runner, target) # # #except ImportError: # pass
Disable Cython test until Cython support new pythonic layout
Disable Cython test until Cython support new pythonic layout
Python
bsd-3-clause
serge-sans-paille/pythran,serge-sans-paille/pythran,pombredanne/pythran,pombredanne/pythran,pombredanne/pythran
import os import unittest class TestCython(unittest.TestCase): pass def add_test(name, runner, target): setattr(TestCython, "test_" + name, lambda s: runner(s, target)) try: import Cython import glob import sys targets = glob.glob(os.path.join(os.path.dirname(__file__), "cython", "setup_*.py")) sys.path.append(os.path.join(os.path.dirname(__file__), "cython")) for target in targets: def runner(self, target): cwd = os.getcwd() try: os.chdir(os.path.dirname(target)) exec(open(os.path.basename(target)).read()) except: raise finally: os.chdir(cwd) name, _ = os.path.splitext(os.path.basename(target)) add_test(name, runner, target) except ImportError: pass Disable Cython test until Cython support new pythonic layout
import os import unittest class TestCython(unittest.TestCase): pass # Needs to wait unil cython supports pythran new builtins naming #def add_test(name, runner, target): # setattr(TestCython, "test_" + name, lambda s: runner(s, target)) # #try: # import Cython # import glob # import sys # targets = glob.glob(os.path.join(os.path.dirname(__file__), "cython", "setup_*.py")) # sys.path.append(os.path.join(os.path.dirname(__file__), "cython")) # # for target in targets: # def runner(self, target): # cwd = os.getcwd() # try: # os.chdir(os.path.dirname(target)) # exec(open(os.path.basename(target)).read()) # except: # raise # finally: # os.chdir(cwd) # name, _ = os.path.splitext(os.path.basename(target)) # add_test(name, runner, target) # # #except ImportError: # pass
<commit_before>import os import unittest class TestCython(unittest.TestCase): pass def add_test(name, runner, target): setattr(TestCython, "test_" + name, lambda s: runner(s, target)) try: import Cython import glob import sys targets = glob.glob(os.path.join(os.path.dirname(__file__), "cython", "setup_*.py")) sys.path.append(os.path.join(os.path.dirname(__file__), "cython")) for target in targets: def runner(self, target): cwd = os.getcwd() try: os.chdir(os.path.dirname(target)) exec(open(os.path.basename(target)).read()) except: raise finally: os.chdir(cwd) name, _ = os.path.splitext(os.path.basename(target)) add_test(name, runner, target) except ImportError: pass <commit_msg>Disable Cython test until Cython support new pythonic layout<commit_after>
import os import unittest class TestCython(unittest.TestCase): pass # Needs to wait unil cython supports pythran new builtins naming #def add_test(name, runner, target): # setattr(TestCython, "test_" + name, lambda s: runner(s, target)) # #try: # import Cython # import glob # import sys # targets = glob.glob(os.path.join(os.path.dirname(__file__), "cython", "setup_*.py")) # sys.path.append(os.path.join(os.path.dirname(__file__), "cython")) # # for target in targets: # def runner(self, target): # cwd = os.getcwd() # try: # os.chdir(os.path.dirname(target)) # exec(open(os.path.basename(target)).read()) # except: # raise # finally: # os.chdir(cwd) # name, _ = os.path.splitext(os.path.basename(target)) # add_test(name, runner, target) # # #except ImportError: # pass
import os import unittest class TestCython(unittest.TestCase): pass def add_test(name, runner, target): setattr(TestCython, "test_" + name, lambda s: runner(s, target)) try: import Cython import glob import sys targets = glob.glob(os.path.join(os.path.dirname(__file__), "cython", "setup_*.py")) sys.path.append(os.path.join(os.path.dirname(__file__), "cython")) for target in targets: def runner(self, target): cwd = os.getcwd() try: os.chdir(os.path.dirname(target)) exec(open(os.path.basename(target)).read()) except: raise finally: os.chdir(cwd) name, _ = os.path.splitext(os.path.basename(target)) add_test(name, runner, target) except ImportError: pass Disable Cython test until Cython support new pythonic layoutimport os import unittest class TestCython(unittest.TestCase): pass # Needs to wait unil cython supports pythran new builtins naming #def add_test(name, runner, target): # setattr(TestCython, "test_" + name, lambda s: runner(s, target)) # #try: # import Cython # import glob # import sys # targets = glob.glob(os.path.join(os.path.dirname(__file__), "cython", "setup_*.py")) # sys.path.append(os.path.join(os.path.dirname(__file__), "cython")) # # for target in targets: # def runner(self, target): # cwd = os.getcwd() # try: # os.chdir(os.path.dirname(target)) # exec(open(os.path.basename(target)).read()) # except: # raise # finally: # os.chdir(cwd) # name, _ = os.path.splitext(os.path.basename(target)) # add_test(name, runner, target) # # #except ImportError: # pass
<commit_before>import os import unittest class TestCython(unittest.TestCase): pass def add_test(name, runner, target): setattr(TestCython, "test_" + name, lambda s: runner(s, target)) try: import Cython import glob import sys targets = glob.glob(os.path.join(os.path.dirname(__file__), "cython", "setup_*.py")) sys.path.append(os.path.join(os.path.dirname(__file__), "cython")) for target in targets: def runner(self, target): cwd = os.getcwd() try: os.chdir(os.path.dirname(target)) exec(open(os.path.basename(target)).read()) except: raise finally: os.chdir(cwd) name, _ = os.path.splitext(os.path.basename(target)) add_test(name, runner, target) except ImportError: pass <commit_msg>Disable Cython test until Cython support new pythonic layout<commit_after>import os import unittest class TestCython(unittest.TestCase): pass # Needs to wait unil cython supports pythran new builtins naming #def add_test(name, runner, target): # setattr(TestCython, "test_" + name, lambda s: runner(s, target)) # #try: # import Cython # import glob # import sys # targets = glob.glob(os.path.join(os.path.dirname(__file__), "cython", "setup_*.py")) # sys.path.append(os.path.join(os.path.dirname(__file__), "cython")) # # for target in targets: # def runner(self, target): # cwd = os.getcwd() # try: # os.chdir(os.path.dirname(target)) # exec(open(os.path.basename(target)).read()) # except: # raise # finally: # os.chdir(cwd) # name, _ = os.path.splitext(os.path.basename(target)) # add_test(name, runner, target) # # #except ImportError: # pass
fb1581dd11cfc74a5c3888430d1f288974e40c76
giphy.py
giphy.py
# -*- coding: utf-8 -*- # # Insert a random giphy URL based on a search # # Usage: /giphy search # # History: # # Version 1.0.1: Auto post gif URL along with query string # Version 1.0.0: initial release # import requests import weechat URL = "http://api.giphy.com/v1/gifs/random?api_key=dc6zaTOxFJmzC&tag=%s" def giphy(data, buf, args): search = args.replace(" ", "+") response = requests.get(URL % search) data = response.json() image_url = data["data"]["image_url"] weechat.command(buf, " /giphy %s -- %s" % (search, image_url)) return weechat.WEECHAT_RC_OK def main(): if not weechat.register("giphy", "Keith Smiley", "1.0.0", "MIT", "Insert a random giphy URL", "", ""): return weechat.WEECHAT_RC_ERROR weechat.hook_command("giphy", "Insert a random giphy URL", "", "", "", "giphy", "") if __name__ == "__main__": main()
# -*- coding: utf-8 -*- # # Insert a random giphy URL based on a search # # Usage: /giphy search # # History: # # Version 1.0.2: Write text if no matches are found # Version 1.0.1: Auto post gif URL along with query string # Version 1.0.0: initial release # import requests import weechat URL = "http://api.giphy.com/v1/gifs/random?api_key=dc6zaTOxFJmzC&tag=%s" def giphy(data, buf, args): search = args.replace(" ", "+") response = requests.get(URL % search) data = response.json() try: image_url = data["data"]["image_url"] except TypeError: image_url = "No matches found" weechat.command(buf, " /giphy %s -- %s" % (search, image_url)) return weechat.WEECHAT_RC_OK def main(): if not weechat.register("giphy", "Keith Smiley", "1.0.0", "MIT", "Insert a random giphy URL", "", ""): return weechat.WEECHAT_RC_ERROR weechat.hook_command("giphy", "Insert a random giphy URL", "", "", "", "giphy", "") if __name__ == "__main__": main()
Write error if no matching gifs are found
Write error if no matching gifs are found
Python
mit
keith/giphy-weechat
# -*- coding: utf-8 -*- # # Insert a random giphy URL based on a search # # Usage: /giphy search # # History: # # Version 1.0.1: Auto post gif URL along with query string # Version 1.0.0: initial release # import requests import weechat URL = "http://api.giphy.com/v1/gifs/random?api_key=dc6zaTOxFJmzC&tag=%s" def giphy(data, buf, args): search = args.replace(" ", "+") response = requests.get(URL % search) data = response.json() image_url = data["data"]["image_url"] weechat.command(buf, " /giphy %s -- %s" % (search, image_url)) return weechat.WEECHAT_RC_OK def main(): if not weechat.register("giphy", "Keith Smiley", "1.0.0", "MIT", "Insert a random giphy URL", "", ""): return weechat.WEECHAT_RC_ERROR weechat.hook_command("giphy", "Insert a random giphy URL", "", "", "", "giphy", "") if __name__ == "__main__": main() Write error if no matching gifs are found
# -*- coding: utf-8 -*- # # Insert a random giphy URL based on a search # # Usage: /giphy search # # History: # # Version 1.0.2: Write text if no matches are found # Version 1.0.1: Auto post gif URL along with query string # Version 1.0.0: initial release # import requests import weechat URL = "http://api.giphy.com/v1/gifs/random?api_key=dc6zaTOxFJmzC&tag=%s" def giphy(data, buf, args): search = args.replace(" ", "+") response = requests.get(URL % search) data = response.json() try: image_url = data["data"]["image_url"] except TypeError: image_url = "No matches found" weechat.command(buf, " /giphy %s -- %s" % (search, image_url)) return weechat.WEECHAT_RC_OK def main(): if not weechat.register("giphy", "Keith Smiley", "1.0.0", "MIT", "Insert a random giphy URL", "", ""): return weechat.WEECHAT_RC_ERROR weechat.hook_command("giphy", "Insert a random giphy URL", "", "", "", "giphy", "") if __name__ == "__main__": main()
<commit_before># -*- coding: utf-8 -*- # # Insert a random giphy URL based on a search # # Usage: /giphy search # # History: # # Version 1.0.1: Auto post gif URL along with query string # Version 1.0.0: initial release # import requests import weechat URL = "http://api.giphy.com/v1/gifs/random?api_key=dc6zaTOxFJmzC&tag=%s" def giphy(data, buf, args): search = args.replace(" ", "+") response = requests.get(URL % search) data = response.json() image_url = data["data"]["image_url"] weechat.command(buf, " /giphy %s -- %s" % (search, image_url)) return weechat.WEECHAT_RC_OK def main(): if not weechat.register("giphy", "Keith Smiley", "1.0.0", "MIT", "Insert a random giphy URL", "", ""): return weechat.WEECHAT_RC_ERROR weechat.hook_command("giphy", "Insert a random giphy URL", "", "", "", "giphy", "") if __name__ == "__main__": main() <commit_msg>Write error if no matching gifs are found<commit_after>
# -*- coding: utf-8 -*- # # Insert a random giphy URL based on a search # # Usage: /giphy search # # History: # # Version 1.0.2: Write text if no matches are found # Version 1.0.1: Auto post gif URL along with query string # Version 1.0.0: initial release # import requests import weechat URL = "http://api.giphy.com/v1/gifs/random?api_key=dc6zaTOxFJmzC&tag=%s" def giphy(data, buf, args): search = args.replace(" ", "+") response = requests.get(URL % search) data = response.json() try: image_url = data["data"]["image_url"] except TypeError: image_url = "No matches found" weechat.command(buf, " /giphy %s -- %s" % (search, image_url)) return weechat.WEECHAT_RC_OK def main(): if not weechat.register("giphy", "Keith Smiley", "1.0.0", "MIT", "Insert a random giphy URL", "", ""): return weechat.WEECHAT_RC_ERROR weechat.hook_command("giphy", "Insert a random giphy URL", "", "", "", "giphy", "") if __name__ == "__main__": main()
# -*- coding: utf-8 -*- # # Insert a random giphy URL based on a search # # Usage: /giphy search # # History: # # Version 1.0.1: Auto post gif URL along with query string # Version 1.0.0: initial release # import requests import weechat URL = "http://api.giphy.com/v1/gifs/random?api_key=dc6zaTOxFJmzC&tag=%s" def giphy(data, buf, args): search = args.replace(" ", "+") response = requests.get(URL % search) data = response.json() image_url = data["data"]["image_url"] weechat.command(buf, " /giphy %s -- %s" % (search, image_url)) return weechat.WEECHAT_RC_OK def main(): if not weechat.register("giphy", "Keith Smiley", "1.0.0", "MIT", "Insert a random giphy URL", "", ""): return weechat.WEECHAT_RC_ERROR weechat.hook_command("giphy", "Insert a random giphy URL", "", "", "", "giphy", "") if __name__ == "__main__": main() Write error if no matching gifs are found# -*- coding: utf-8 -*- # # Insert a random giphy URL based on a search # # Usage: /giphy search # # History: # # Version 1.0.2: Write text if no matches are found # Version 1.0.1: Auto post gif URL along with query string # Version 1.0.0: initial release # import requests import weechat URL = "http://api.giphy.com/v1/gifs/random?api_key=dc6zaTOxFJmzC&tag=%s" def giphy(data, buf, args): search = args.replace(" ", "+") response = requests.get(URL % search) data = response.json() try: image_url = data["data"]["image_url"] except TypeError: image_url = "No matches found" weechat.command(buf, " /giphy %s -- %s" % (search, image_url)) return weechat.WEECHAT_RC_OK def main(): if not weechat.register("giphy", "Keith Smiley", "1.0.0", "MIT", "Insert a random giphy URL", "", ""): return weechat.WEECHAT_RC_ERROR weechat.hook_command("giphy", "Insert a random giphy URL", "", "", "", "giphy", "") if __name__ == "__main__": main()
<commit_before># -*- coding: utf-8 -*- # # Insert a random giphy URL based on a search # # Usage: /giphy search # # History: # # Version 1.0.1: Auto post gif URL along with query string # Version 1.0.0: initial release # import requests import weechat URL = "http://api.giphy.com/v1/gifs/random?api_key=dc6zaTOxFJmzC&tag=%s" def giphy(data, buf, args): search = args.replace(" ", "+") response = requests.get(URL % search) data = response.json() image_url = data["data"]["image_url"] weechat.command(buf, " /giphy %s -- %s" % (search, image_url)) return weechat.WEECHAT_RC_OK def main(): if not weechat.register("giphy", "Keith Smiley", "1.0.0", "MIT", "Insert a random giphy URL", "", ""): return weechat.WEECHAT_RC_ERROR weechat.hook_command("giphy", "Insert a random giphy URL", "", "", "", "giphy", "") if __name__ == "__main__": main() <commit_msg>Write error if no matching gifs are found<commit_after># -*- coding: utf-8 -*- # # Insert a random giphy URL based on a search # # Usage: /giphy search # # History: # # Version 1.0.2: Write text if no matches are found # Version 1.0.1: Auto post gif URL along with query string # Version 1.0.0: initial release # import requests import weechat URL = "http://api.giphy.com/v1/gifs/random?api_key=dc6zaTOxFJmzC&tag=%s" def giphy(data, buf, args): search = args.replace(" ", "+") response = requests.get(URL % search) data = response.json() try: image_url = data["data"]["image_url"] except TypeError: image_url = "No matches found" weechat.command(buf, " /giphy %s -- %s" % (search, image_url)) return weechat.WEECHAT_RC_OK def main(): if not weechat.register("giphy", "Keith Smiley", "1.0.0", "MIT", "Insert a random giphy URL", "", ""): return weechat.WEECHAT_RC_ERROR weechat.hook_command("giphy", "Insert a random giphy URL", "", "", "", "giphy", "") if __name__ == "__main__": main()
1eb411a45f74819a039dfc1330decb212e1961a6
rollbar/test/async_helper.py
rollbar/test/async_helper.py
import asyncio import inspect import sys import rollbar def run(coro): if sys.version_info >= (3, 7): return asyncio.run(coro) assert inspect.iscoroutine(coro) loop = asyncio.new_event_loop() asyncio.set_event_loop(loop) try: return loop.run_until_complete(coro) finally: loop.close() asyncio.set_event_loop(None) def async_receive(message): async def receive(): return message assert message['type'] == 'http.request' return receive class FailingTestASGIApp: def __call__(self, scope, receive, send): try: run(self.app(scope, receive, send)) except Exception: if scope['type'] == 'http': rollbar.report_exc_info() raise async def app(self, scope, receive, send): raise RuntimeError('Invoked only for testing')
import asyncio import inspect import sys import rollbar def run(coro): if sys.version_info >= (3, 7): return asyncio.run(coro) assert inspect.iscoroutine(coro) loop = asyncio.new_event_loop() asyncio.set_event_loop(loop) try: return loop.run_until_complete(coro) finally: loop.close() asyncio.set_event_loop(None) def async_receive(message): async def receive(): return message assert message['type'] == 'http.request' return receive class FailingTestASGIApp: def __call__(self, scope, receive, send): try: run(self.app(scope, receive, send)) except Exception: if scope['type'] == 'http': rollbar.report_exc_info() raise async def app(self, scope, receive, send): raise RuntimeError('Invoked only for testing') class BareMiddleware: def __init__(self, app): self.app = app async def __call__(self, scope, receive, send): await self.app(scope, receive, send)
Add BareMiddleware to test helpers
Add BareMiddleware to test helpers
Python
mit
rollbar/pyrollbar
import asyncio import inspect import sys import rollbar def run(coro): if sys.version_info >= (3, 7): return asyncio.run(coro) assert inspect.iscoroutine(coro) loop = asyncio.new_event_loop() asyncio.set_event_loop(loop) try: return loop.run_until_complete(coro) finally: loop.close() asyncio.set_event_loop(None) def async_receive(message): async def receive(): return message assert message['type'] == 'http.request' return receive class FailingTestASGIApp: def __call__(self, scope, receive, send): try: run(self.app(scope, receive, send)) except Exception: if scope['type'] == 'http': rollbar.report_exc_info() raise async def app(self, scope, receive, send): raise RuntimeError('Invoked only for testing') Add BareMiddleware to test helpers
import asyncio import inspect import sys import rollbar def run(coro): if sys.version_info >= (3, 7): return asyncio.run(coro) assert inspect.iscoroutine(coro) loop = asyncio.new_event_loop() asyncio.set_event_loop(loop) try: return loop.run_until_complete(coro) finally: loop.close() asyncio.set_event_loop(None) def async_receive(message): async def receive(): return message assert message['type'] == 'http.request' return receive class FailingTestASGIApp: def __call__(self, scope, receive, send): try: run(self.app(scope, receive, send)) except Exception: if scope['type'] == 'http': rollbar.report_exc_info() raise async def app(self, scope, receive, send): raise RuntimeError('Invoked only for testing') class BareMiddleware: def __init__(self, app): self.app = app async def __call__(self, scope, receive, send): await self.app(scope, receive, send)
<commit_before>import asyncio import inspect import sys import rollbar def run(coro): if sys.version_info >= (3, 7): return asyncio.run(coro) assert inspect.iscoroutine(coro) loop = asyncio.new_event_loop() asyncio.set_event_loop(loop) try: return loop.run_until_complete(coro) finally: loop.close() asyncio.set_event_loop(None) def async_receive(message): async def receive(): return message assert message['type'] == 'http.request' return receive class FailingTestASGIApp: def __call__(self, scope, receive, send): try: run(self.app(scope, receive, send)) except Exception: if scope['type'] == 'http': rollbar.report_exc_info() raise async def app(self, scope, receive, send): raise RuntimeError('Invoked only for testing') <commit_msg>Add BareMiddleware to test helpers<commit_after>
import asyncio import inspect import sys import rollbar def run(coro): if sys.version_info >= (3, 7): return asyncio.run(coro) assert inspect.iscoroutine(coro) loop = asyncio.new_event_loop() asyncio.set_event_loop(loop) try: return loop.run_until_complete(coro) finally: loop.close() asyncio.set_event_loop(None) def async_receive(message): async def receive(): return message assert message['type'] == 'http.request' return receive class FailingTestASGIApp: def __call__(self, scope, receive, send): try: run(self.app(scope, receive, send)) except Exception: if scope['type'] == 'http': rollbar.report_exc_info() raise async def app(self, scope, receive, send): raise RuntimeError('Invoked only for testing') class BareMiddleware: def __init__(self, app): self.app = app async def __call__(self, scope, receive, send): await self.app(scope, receive, send)
import asyncio import inspect import sys import rollbar def run(coro): if sys.version_info >= (3, 7): return asyncio.run(coro) assert inspect.iscoroutine(coro) loop = asyncio.new_event_loop() asyncio.set_event_loop(loop) try: return loop.run_until_complete(coro) finally: loop.close() asyncio.set_event_loop(None) def async_receive(message): async def receive(): return message assert message['type'] == 'http.request' return receive class FailingTestASGIApp: def __call__(self, scope, receive, send): try: run(self.app(scope, receive, send)) except Exception: if scope['type'] == 'http': rollbar.report_exc_info() raise async def app(self, scope, receive, send): raise RuntimeError('Invoked only for testing') Add BareMiddleware to test helpersimport asyncio import inspect import sys import rollbar def run(coro): if sys.version_info >= (3, 7): return asyncio.run(coro) assert inspect.iscoroutine(coro) loop = asyncio.new_event_loop() asyncio.set_event_loop(loop) try: return loop.run_until_complete(coro) finally: loop.close() asyncio.set_event_loop(None) def async_receive(message): async def receive(): return message assert message['type'] == 'http.request' return receive class FailingTestASGIApp: def __call__(self, scope, receive, send): try: run(self.app(scope, receive, send)) except Exception: if scope['type'] == 'http': rollbar.report_exc_info() raise async def app(self, scope, receive, send): raise RuntimeError('Invoked only for testing') class BareMiddleware: def __init__(self, app): self.app = app async def __call__(self, scope, receive, send): await self.app(scope, receive, send)
<commit_before>import asyncio import inspect import sys import rollbar def run(coro): if sys.version_info >= (3, 7): return asyncio.run(coro) assert inspect.iscoroutine(coro) loop = asyncio.new_event_loop() asyncio.set_event_loop(loop) try: return loop.run_until_complete(coro) finally: loop.close() asyncio.set_event_loop(None) def async_receive(message): async def receive(): return message assert message['type'] == 'http.request' return receive class FailingTestASGIApp: def __call__(self, scope, receive, send): try: run(self.app(scope, receive, send)) except Exception: if scope['type'] == 'http': rollbar.report_exc_info() raise async def app(self, scope, receive, send): raise RuntimeError('Invoked only for testing') <commit_msg>Add BareMiddleware to test helpers<commit_after>import asyncio import inspect import sys import rollbar def run(coro): if sys.version_info >= (3, 7): return asyncio.run(coro) assert inspect.iscoroutine(coro) loop = asyncio.new_event_loop() asyncio.set_event_loop(loop) try: return loop.run_until_complete(coro) finally: loop.close() asyncio.set_event_loop(None) def async_receive(message): async def receive(): return message assert message['type'] == 'http.request' return receive class FailingTestASGIApp: def __call__(self, scope, receive, send): try: run(self.app(scope, receive, send)) except Exception: if scope['type'] == 'http': rollbar.report_exc_info() raise async def app(self, scope, receive, send): raise RuntimeError('Invoked only for testing') class BareMiddleware: def __init__(self, app): self.app = app async def __call__(self, scope, receive, send): await self.app(scope, receive, send)
a1be44dcc93a336232807f3ef79a03e73ca31f65
froniusLogger.py
froniusLogger.py
""" Logs key data from a Fronius inverter to a CSV file for later analysis. [email protected] """ import requests import json import datetime import time # Set this to the IP address of your inverter host = "192.168.0.112" sample_seconds = 60 # how many seconds between samples, set to zero to run once and exit def main(): print("started") while True: try: watts = watts_generated() now = time.strftime("%H:%M:%S") line = "%s\t%s\n" % (now, watts) # print(line) write_to_logfile(line) except requests.exceptions.ConnectTimeout: print("Connect timeout") if sample_seconds > 0: time.sleep(sample_seconds) else: return def write_to_logfile(line): today = time.strftime("%Y_%m_%d") file_name = today + ".csv" out_file = open(file_name, "a") out_file.write(line) out_file.close() def watts_generated(): url = "http://" + host + "/solar_api/v1/GetInverterRealtimeData.cgi?Scope=System" r = requests.get(url, timeout=2) json_data = r.json() result = json_data["Body"]["Data"]["PAC"]["Values"]["1"] return result if __name__ == "__main__": main()
""" Logs key data from a Fronius inverter to a CSV file for later analysis. [email protected] """ import requests import json import datetime import time # Set this to the IP address of your inverter host = "192.168.0.112" # number of seconds between samples, set to zero to run once and exit sample_seconds = 60 * 5 def main(): print("started") while True: try: watts = watts_generated() now = time.strftime("%H:%M:%S") line = "%s\t%s\n" % (now, watts) # print(line) write_to_logfile(line) except requests.exceptions.ConnectTimeout: print("Connect timeout at %s" % time.strftime("%H:%M:%S")) if sample_seconds > 0: time.sleep(sample_seconds) else: return def write_to_logfile(line): today = time.strftime("%Y_%m_%d") file_name = today + ".csv" out_file = open(file_name, "a") out_file.write(line) out_file.close() def watts_generated(): url = "http://" + host + "/solar_api/v1/GetInverterRealtimeData.cgi?Scope=System" r = requests.get(url, timeout=2) json_data = r.json() result = json_data["Body"]["Data"]["PAC"]["Values"]["1"] return result if __name__ == "__main__": main()
Set sample times to every 5 minutes. Show the time of a timeout.
Set sample times to every 5 minutes. Show the time of a timeout.
Python
apache-2.0
peterbmarks/froniusLogger,peterbmarks/froniusLogger
""" Logs key data from a Fronius inverter to a CSV file for later analysis. [email protected] """ import requests import json import datetime import time # Set this to the IP address of your inverter host = "192.168.0.112" sample_seconds = 60 # how many seconds between samples, set to zero to run once and exit def main(): print("started") while True: try: watts = watts_generated() now = time.strftime("%H:%M:%S") line = "%s\t%s\n" % (now, watts) # print(line) write_to_logfile(line) except requests.exceptions.ConnectTimeout: print("Connect timeout") if sample_seconds > 0: time.sleep(sample_seconds) else: return def write_to_logfile(line): today = time.strftime("%Y_%m_%d") file_name = today + ".csv" out_file = open(file_name, "a") out_file.write(line) out_file.close() def watts_generated(): url = "http://" + host + "/solar_api/v1/GetInverterRealtimeData.cgi?Scope=System" r = requests.get(url, timeout=2) json_data = r.json() result = json_data["Body"]["Data"]["PAC"]["Values"]["1"] return result if __name__ == "__main__": main() Set sample times to every 5 minutes. Show the time of a timeout.
""" Logs key data from a Fronius inverter to a CSV file for later analysis. [email protected] """ import requests import json import datetime import time # Set this to the IP address of your inverter host = "192.168.0.112" # number of seconds between samples, set to zero to run once and exit sample_seconds = 60 * 5 def main(): print("started") while True: try: watts = watts_generated() now = time.strftime("%H:%M:%S") line = "%s\t%s\n" % (now, watts) # print(line) write_to_logfile(line) except requests.exceptions.ConnectTimeout: print("Connect timeout at %s" % time.strftime("%H:%M:%S")) if sample_seconds > 0: time.sleep(sample_seconds) else: return def write_to_logfile(line): today = time.strftime("%Y_%m_%d") file_name = today + ".csv" out_file = open(file_name, "a") out_file.write(line) out_file.close() def watts_generated(): url = "http://" + host + "/solar_api/v1/GetInverterRealtimeData.cgi?Scope=System" r = requests.get(url, timeout=2) json_data = r.json() result = json_data["Body"]["Data"]["PAC"]["Values"]["1"] return result if __name__ == "__main__": main()
<commit_before>""" Logs key data from a Fronius inverter to a CSV file for later analysis. [email protected] """ import requests import json import datetime import time # Set this to the IP address of your inverter host = "192.168.0.112" sample_seconds = 60 # how many seconds between samples, set to zero to run once and exit def main(): print("started") while True: try: watts = watts_generated() now = time.strftime("%H:%M:%S") line = "%s\t%s\n" % (now, watts) # print(line) write_to_logfile(line) except requests.exceptions.ConnectTimeout: print("Connect timeout") if sample_seconds > 0: time.sleep(sample_seconds) else: return def write_to_logfile(line): today = time.strftime("%Y_%m_%d") file_name = today + ".csv" out_file = open(file_name, "a") out_file.write(line) out_file.close() def watts_generated(): url = "http://" + host + "/solar_api/v1/GetInverterRealtimeData.cgi?Scope=System" r = requests.get(url, timeout=2) json_data = r.json() result = json_data["Body"]["Data"]["PAC"]["Values"]["1"] return result if __name__ == "__main__": main() <commit_msg>Set sample times to every 5 minutes. Show the time of a timeout.<commit_after>
""" Logs key data from a Fronius inverter to a CSV file for later analysis. [email protected] """ import requests import json import datetime import time # Set this to the IP address of your inverter host = "192.168.0.112" # number of seconds between samples, set to zero to run once and exit sample_seconds = 60 * 5 def main(): print("started") while True: try: watts = watts_generated() now = time.strftime("%H:%M:%S") line = "%s\t%s\n" % (now, watts) # print(line) write_to_logfile(line) except requests.exceptions.ConnectTimeout: print("Connect timeout at %s" % time.strftime("%H:%M:%S")) if sample_seconds > 0: time.sleep(sample_seconds) else: return def write_to_logfile(line): today = time.strftime("%Y_%m_%d") file_name = today + ".csv" out_file = open(file_name, "a") out_file.write(line) out_file.close() def watts_generated(): url = "http://" + host + "/solar_api/v1/GetInverterRealtimeData.cgi?Scope=System" r = requests.get(url, timeout=2) json_data = r.json() result = json_data["Body"]["Data"]["PAC"]["Values"]["1"] return result if __name__ == "__main__": main()
""" Logs key data from a Fronius inverter to a CSV file for later analysis. [email protected] """ import requests import json import datetime import time # Set this to the IP address of your inverter host = "192.168.0.112" sample_seconds = 60 # how many seconds between samples, set to zero to run once and exit def main(): print("started") while True: try: watts = watts_generated() now = time.strftime("%H:%M:%S") line = "%s\t%s\n" % (now, watts) # print(line) write_to_logfile(line) except requests.exceptions.ConnectTimeout: print("Connect timeout") if sample_seconds > 0: time.sleep(sample_seconds) else: return def write_to_logfile(line): today = time.strftime("%Y_%m_%d") file_name = today + ".csv" out_file = open(file_name, "a") out_file.write(line) out_file.close() def watts_generated(): url = "http://" + host + "/solar_api/v1/GetInverterRealtimeData.cgi?Scope=System" r = requests.get(url, timeout=2) json_data = r.json() result = json_data["Body"]["Data"]["PAC"]["Values"]["1"] return result if __name__ == "__main__": main() Set sample times to every 5 minutes. Show the time of a timeout.""" Logs key data from a Fronius inverter to a CSV file for later analysis. [email protected] """ import requests import json import datetime import time # Set this to the IP address of your inverter host = "192.168.0.112" # number of seconds between samples, set to zero to run once and exit sample_seconds = 60 * 5 def main(): print("started") while True: try: watts = watts_generated() now = time.strftime("%H:%M:%S") line = "%s\t%s\n" % (now, watts) # print(line) write_to_logfile(line) except requests.exceptions.ConnectTimeout: print("Connect timeout at %s" % time.strftime("%H:%M:%S")) if sample_seconds > 0: time.sleep(sample_seconds) else: return def write_to_logfile(line): today = time.strftime("%Y_%m_%d") file_name = today + ".csv" out_file = open(file_name, "a") out_file.write(line) out_file.close() def watts_generated(): url = "http://" + host + "/solar_api/v1/GetInverterRealtimeData.cgi?Scope=System" r = requests.get(url, timeout=2) json_data = r.json() result = json_data["Body"]["Data"]["PAC"]["Values"]["1"] return result if __name__ == "__main__": main()
<commit_before>""" Logs key data from a Fronius inverter to a CSV file for later analysis. [email protected] """ import requests import json import datetime import time # Set this to the IP address of your inverter host = "192.168.0.112" sample_seconds = 60 # how many seconds between samples, set to zero to run once and exit def main(): print("started") while True: try: watts = watts_generated() now = time.strftime("%H:%M:%S") line = "%s\t%s\n" % (now, watts) # print(line) write_to_logfile(line) except requests.exceptions.ConnectTimeout: print("Connect timeout") if sample_seconds > 0: time.sleep(sample_seconds) else: return def write_to_logfile(line): today = time.strftime("%Y_%m_%d") file_name = today + ".csv" out_file = open(file_name, "a") out_file.write(line) out_file.close() def watts_generated(): url = "http://" + host + "/solar_api/v1/GetInverterRealtimeData.cgi?Scope=System" r = requests.get(url, timeout=2) json_data = r.json() result = json_data["Body"]["Data"]["PAC"]["Values"]["1"] return result if __name__ == "__main__": main() <commit_msg>Set sample times to every 5 minutes. Show the time of a timeout.<commit_after>""" Logs key data from a Fronius inverter to a CSV file for later analysis. [email protected] """ import requests import json import datetime import time # Set this to the IP address of your inverter host = "192.168.0.112" # number of seconds between samples, set to zero to run once and exit sample_seconds = 60 * 5 def main(): print("started") while True: try: watts = watts_generated() now = time.strftime("%H:%M:%S") line = "%s\t%s\n" % (now, watts) # print(line) write_to_logfile(line) except requests.exceptions.ConnectTimeout: print("Connect timeout at %s" % time.strftime("%H:%M:%S")) if sample_seconds > 0: time.sleep(sample_seconds) else: return def write_to_logfile(line): today = time.strftime("%Y_%m_%d") file_name = today + ".csv" out_file = open(file_name, "a") out_file.write(line) out_file.close() def watts_generated(): url = "http://" + host + "/solar_api/v1/GetInverterRealtimeData.cgi?Scope=System" r = requests.get(url, timeout=2) json_data = r.json() result = json_data["Body"]["Data"]["PAC"]["Values"]["1"] return result if __name__ == "__main__": main()
6aa3ed3634a22b89f7128883d20f28f65ed00152
basic.py
basic.py
import os # needed for opening/compiling file import time # needed for delay def getPath(allowCancel = True): """Ask the user for lilypond file path and return it as string. Takes one boolean argument as to whether message should say cancelling is allowed or not. Defaults to true, however this may not be suitable for where the path is needed for initialisation.""" if allowCancel == True: question = "Enter path of lilypond file (including file but without extension), or enter nothing to cancel: " else: question = "Enter path of lilypond file (including file but without extension): " path = raw_input(question) return path logwait = 5 # how long the program waits before opening the log answer = "" path = "" while path == "": path = getPath(False) while answer.lower() != "e": answer = raw_input("Enter Y or C to compile, E to exit, or P to change file path: ") if answer.lower() == "y" or answer.lower() == "c": os.startfile(path + ".ly") print "Opening log file in " + str(logwait) + " seconds..." time.sleep(logwait) print "Log file: ==========================" logfile = open(path + ".log", "r") print logfile.read() print "End of log file: ===================" print "====================================" elif answer.lower() == "p": path = getPath()
import os; # needed for opening/compiling file import time; # needed for delay def getPath(allowCancel = True): """Ask the user for lilypond file path and return it as string. Takes one boolean argument as to whether message should say cancelling is allowed or not. Defaults to true, however this may not be suitable for where the path is needed for initialisation.""" if allowCancel == True: question = "Enter path of lilypond file (including file but without extension), or enter nothing to cancel: "; else: question = "Enter path of lilypond file (including file but without extension): "; path = raw_input(question); return path; logwait = 5; # how long the program waits before opening the log answer = ""; path = ""; while path == "": path = getPath(False); while answer.lower() != "e": answer = raw_input("Enter Y or C to compile, E to exit, or P to change file path: "); if answer.lower() == "y" or answer.lower() == "c": os.startfile(path + ".ly"); print "Opening log file in " + str(logwait) + " seconds..."; time.sleep(logwait); print "Log file: =========================="; logfile = open(path + ".log", "r"); print logfile.read(); print "End of log file: ==================="; print "===================================="; elif answer.lower() == "p": path = getPath();
Add semicolons to end of program statements
Add semicolons to end of program statements
Python
unlicense
RainCity471/lyCompiler
import os # needed for opening/compiling file import time # needed for delay def getPath(allowCancel = True): """Ask the user for lilypond file path and return it as string. Takes one boolean argument as to whether message should say cancelling is allowed or not. Defaults to true, however this may not be suitable for where the path is needed for initialisation.""" if allowCancel == True: question = "Enter path of lilypond file (including file but without extension), or enter nothing to cancel: " else: question = "Enter path of lilypond file (including file but without extension): " path = raw_input(question) return path logwait = 5 # how long the program waits before opening the log answer = "" path = "" while path == "": path = getPath(False) while answer.lower() != "e": answer = raw_input("Enter Y or C to compile, E to exit, or P to change file path: ") if answer.lower() == "y" or answer.lower() == "c": os.startfile(path + ".ly") print "Opening log file in " + str(logwait) + " seconds..." time.sleep(logwait) print "Log file: ==========================" logfile = open(path + ".log", "r") print logfile.read() print "End of log file: ===================" print "====================================" elif answer.lower() == "p": path = getPath() Add semicolons to end of program statements
import os; # needed for opening/compiling file import time; # needed for delay def getPath(allowCancel = True): """Ask the user for lilypond file path and return it as string. Takes one boolean argument as to whether message should say cancelling is allowed or not. Defaults to true, however this may not be suitable for where the path is needed for initialisation.""" if allowCancel == True: question = "Enter path of lilypond file (including file but without extension), or enter nothing to cancel: "; else: question = "Enter path of lilypond file (including file but without extension): "; path = raw_input(question); return path; logwait = 5; # how long the program waits before opening the log answer = ""; path = ""; while path == "": path = getPath(False); while answer.lower() != "e": answer = raw_input("Enter Y or C to compile, E to exit, or P to change file path: "); if answer.lower() == "y" or answer.lower() == "c": os.startfile(path + ".ly"); print "Opening log file in " + str(logwait) + " seconds..."; time.sleep(logwait); print "Log file: =========================="; logfile = open(path + ".log", "r"); print logfile.read(); print "End of log file: ==================="; print "===================================="; elif answer.lower() == "p": path = getPath();
<commit_before>import os # needed for opening/compiling file import time # needed for delay def getPath(allowCancel = True): """Ask the user for lilypond file path and return it as string. Takes one boolean argument as to whether message should say cancelling is allowed or not. Defaults to true, however this may not be suitable for where the path is needed for initialisation.""" if allowCancel == True: question = "Enter path of lilypond file (including file but without extension), or enter nothing to cancel: " else: question = "Enter path of lilypond file (including file but without extension): " path = raw_input(question) return path logwait = 5 # how long the program waits before opening the log answer = "" path = "" while path == "": path = getPath(False) while answer.lower() != "e": answer = raw_input("Enter Y or C to compile, E to exit, or P to change file path: ") if answer.lower() == "y" or answer.lower() == "c": os.startfile(path + ".ly") print "Opening log file in " + str(logwait) + " seconds..." time.sleep(logwait) print "Log file: ==========================" logfile = open(path + ".log", "r") print logfile.read() print "End of log file: ===================" print "====================================" elif answer.lower() == "p": path = getPath() <commit_msg>Add semicolons to end of program statements<commit_after>
import os; # needed for opening/compiling file import time; # needed for delay def getPath(allowCancel = True): """Ask the user for lilypond file path and return it as string. Takes one boolean argument as to whether message should say cancelling is allowed or not. Defaults to true, however this may not be suitable for where the path is needed for initialisation.""" if allowCancel == True: question = "Enter path of lilypond file (including file but without extension), or enter nothing to cancel: "; else: question = "Enter path of lilypond file (including file but without extension): "; path = raw_input(question); return path; logwait = 5; # how long the program waits before opening the log answer = ""; path = ""; while path == "": path = getPath(False); while answer.lower() != "e": answer = raw_input("Enter Y or C to compile, E to exit, or P to change file path: "); if answer.lower() == "y" or answer.lower() == "c": os.startfile(path + ".ly"); print "Opening log file in " + str(logwait) + " seconds..."; time.sleep(logwait); print "Log file: =========================="; logfile = open(path + ".log", "r"); print logfile.read(); print "End of log file: ==================="; print "===================================="; elif answer.lower() == "p": path = getPath();
import os # needed for opening/compiling file import time # needed for delay def getPath(allowCancel = True): """Ask the user for lilypond file path and return it as string. Takes one boolean argument as to whether message should say cancelling is allowed or not. Defaults to true, however this may not be suitable for where the path is needed for initialisation.""" if allowCancel == True: question = "Enter path of lilypond file (including file but without extension), or enter nothing to cancel: " else: question = "Enter path of lilypond file (including file but without extension): " path = raw_input(question) return path logwait = 5 # how long the program waits before opening the log answer = "" path = "" while path == "": path = getPath(False) while answer.lower() != "e": answer = raw_input("Enter Y or C to compile, E to exit, or P to change file path: ") if answer.lower() == "y" or answer.lower() == "c": os.startfile(path + ".ly") print "Opening log file in " + str(logwait) + " seconds..." time.sleep(logwait) print "Log file: ==========================" logfile = open(path + ".log", "r") print logfile.read() print "End of log file: ===================" print "====================================" elif answer.lower() == "p": path = getPath() Add semicolons to end of program statementsimport os; # needed for opening/compiling file import time; # needed for delay def getPath(allowCancel = True): """Ask the user for lilypond file path and return it as string. Takes one boolean argument as to whether message should say cancelling is allowed or not. Defaults to true, however this may not be suitable for where the path is needed for initialisation.""" if allowCancel == True: question = "Enter path of lilypond file (including file but without extension), or enter nothing to cancel: "; else: question = "Enter path of lilypond file (including file but without extension): "; path = raw_input(question); return path; logwait = 5; # how long the program waits before opening the log answer = ""; path = ""; while path == "": path = getPath(False); while answer.lower() != "e": answer = raw_input("Enter Y or C to compile, E to exit, or P to change file path: "); if answer.lower() == "y" or answer.lower() == "c": os.startfile(path + ".ly"); print "Opening log file in " + str(logwait) + " seconds..."; time.sleep(logwait); print "Log file: =========================="; logfile = open(path + ".log", "r"); print logfile.read(); print "End of log file: ==================="; print "===================================="; elif answer.lower() == "p": path = getPath();
<commit_before>import os # needed for opening/compiling file import time # needed for delay def getPath(allowCancel = True): """Ask the user for lilypond file path and return it as string. Takes one boolean argument as to whether message should say cancelling is allowed or not. Defaults to true, however this may not be suitable for where the path is needed for initialisation.""" if allowCancel == True: question = "Enter path of lilypond file (including file but without extension), or enter nothing to cancel: " else: question = "Enter path of lilypond file (including file but without extension): " path = raw_input(question) return path logwait = 5 # how long the program waits before opening the log answer = "" path = "" while path == "": path = getPath(False) while answer.lower() != "e": answer = raw_input("Enter Y or C to compile, E to exit, or P to change file path: ") if answer.lower() == "y" or answer.lower() == "c": os.startfile(path + ".ly") print "Opening log file in " + str(logwait) + " seconds..." time.sleep(logwait) print "Log file: ==========================" logfile = open(path + ".log", "r") print logfile.read() print "End of log file: ===================" print "====================================" elif answer.lower() == "p": path = getPath() <commit_msg>Add semicolons to end of program statements<commit_after>import os; # needed for opening/compiling file import time; # needed for delay def getPath(allowCancel = True): """Ask the user for lilypond file path and return it as string. Takes one boolean argument as to whether message should say cancelling is allowed or not. Defaults to true, however this may not be suitable for where the path is needed for initialisation.""" if allowCancel == True: question = "Enter path of lilypond file (including file but without extension), or enter nothing to cancel: "; else: question = "Enter path of lilypond file (including file but without extension): "; path = raw_input(question); return path; logwait = 5; # how long the program waits before opening the log answer = ""; path = ""; while path == "": path = getPath(False); while answer.lower() != "e": answer = raw_input("Enter Y or C to compile, E to exit, or P to change file path: "); if answer.lower() == "y" or answer.lower() == "c": os.startfile(path + ".ly"); print "Opening log file in " + str(logwait) + " seconds..."; time.sleep(logwait); print "Log file: =========================="; logfile = open(path + ".log", "r"); print logfile.read(); print "End of log file: ==================="; print "===================================="; elif answer.lower() == "p": path = getPath();
47afbcf83280fdd4cf80119443524240ea8148ad
lms/djangoapps/grades/migrations/0005_multiple_course_flags.py
lms/djangoapps/grades/migrations/0005_multiple_course_flags.py
# -*- coding: utf-8 -*- from __future__ import unicode_literals from django.db import migrations, models from openedx.core.djangoapps.xmodule_django.models import CourseKeyField class Migration(migrations.Migration): dependencies = [ ('grades', '0004_visibleblocks_course_id'), ] operations = [ migrations.AlterField( model_name='coursepersistentgradesflag', name='course_id', field=CourseKeyField(max_length=255, db_index=True), ), ]
# -*- coding: utf-8 -*- from __future__ import unicode_literals from django.db import migrations, models from openedx.core.djangoapps.xmodule_django.models import CourseKeyField class Migration(migrations.Migration): dependencies = [ ('grades', '0004_visibleblocks_course_id'), ] operations = [ migrations.AlterField( model_name='coursepersistentgradesflag', name='course_id', field=CourseKeyField(max_length=255, db_index=True), ), ] def unapply(self, project_state, schema_editor, collect_sql=False): """ This is a bit of a hack. This migration is removing a unique index that was erroneously included in the initial migrations for this app, so it's very likely that IntegrityErrors would result if we did roll this particular migration back. To avoid this, we override the default unapply method and skip the addition of a unique index that was never intended to exist. The assumption here is that you are never going to be specifically targeting a migration < 0005 for grades, and will only ever be migrating backwards if you intend to go all the way back to zero and drop the tables. If this is not the case and you are reading this comment, please file a PR to help us with your intended usage. """ pass
Allow grades app to be zero-migrated
Allow grades app to be zero-migrated
Python
agpl-3.0
jolyonb/edx-platform,ESOedX/edx-platform,ESOedX/edx-platform,synergeticsedx/deployment-wipro,angelapper/edx-platform,TeachAtTUM/edx-platform,Stanford-Online/edx-platform,jzoldak/edx-platform,proversity-org/edx-platform,philanthropy-u/edx-platform,mitocw/edx-platform,ahmedaljazzar/edx-platform,jzoldak/edx-platform,Stanford-Online/edx-platform,amir-qayyum-khan/edx-platform,ahmedaljazzar/edx-platform,Edraak/edraak-platform,appsembler/edx-platform,hastexo/edx-platform,edx/edx-platform,ESOedX/edx-platform,caesar2164/edx-platform,edx-solutions/edx-platform,procangroup/edx-platform,raccoongang/edx-platform,stvstnfrd/edx-platform,edx-solutions/edx-platform,naresh21/synergetics-edx-platform,arbrandes/edx-platform,Stanford-Online/edx-platform,cpennington/edx-platform,lduarte1991/edx-platform,eduNEXT/edx-platform,arbrandes/edx-platform,eduNEXT/edx-platform,naresh21/synergetics-edx-platform,Lektorium-LLC/edx-platform,raccoongang/edx-platform,a-parhom/edx-platform,BehavioralInsightsTeam/edx-platform,teltek/edx-platform,romain-li/edx-platform,kmoocdev2/edx-platform,fintech-circle/edx-platform,cpennington/edx-platform,proversity-org/edx-platform,BehavioralInsightsTeam/edx-platform,hastexo/edx-platform,mitocw/edx-platform,pabloborrego93/edx-platform,TeachAtTUM/edx-platform,EDUlib/edx-platform,lduarte1991/edx-platform,TeachAtTUM/edx-platform,synergeticsedx/deployment-wipro,angelapper/edx-platform,gymnasium/edx-platform,gsehub/edx-platform,Edraak/edraak-platform,appsembler/edx-platform,hastexo/edx-platform,mitocw/edx-platform,jolyonb/edx-platform,amir-qayyum-khan/edx-platform,eduNEXT/edunext-platform,appsembler/edx-platform,gymnasium/edx-platform,romain-li/edx-platform,gsehub/edx-platform,prarthitm/edxplatform,eduNEXT/edunext-platform,BehavioralInsightsTeam/edx-platform,TeachAtTUM/edx-platform,edx/edx-platform,Edraak/edraak-platform,proversity-org/edx-platform,procangroup/edx-platform,fintech-circle/edx-platform,raccoongang/edx-platform,eduNEXT/edunext-platform,prarthitm/edxplatform,gymnasium/edx-platform,eduNEXT/edunext-platform,msegado/edx-platform,pepeportela/edx-platform,jolyonb/edx-platform,romain-li/edx-platform,jzoldak/edx-platform,romain-li/edx-platform,edx/edx-platform,arbrandes/edx-platform,pepeportela/edx-platform,angelapper/edx-platform,philanthropy-u/edx-platform,Lektorium-LLC/edx-platform,prarthitm/edxplatform,naresh21/synergetics-edx-platform,synergeticsedx/deployment-wipro,fintech-circle/edx-platform,miptliot/edx-platform,pepeportela/edx-platform,stvstnfrd/edx-platform,hastexo/edx-platform,kmoocdev2/edx-platform,CredoReference/edx-platform,miptliot/edx-platform,amir-qayyum-khan/edx-platform,pabloborrego93/edx-platform,caesar2164/edx-platform,ahmedaljazzar/edx-platform,teltek/edx-platform,jzoldak/edx-platform,stvstnfrd/edx-platform,ESOedX/edx-platform,Stanford-Online/edx-platform,teltek/edx-platform,pabloborrego93/edx-platform,gsehub/edx-platform,BehavioralInsightsTeam/edx-platform,cpennington/edx-platform,eduNEXT/edx-platform,mitocw/edx-platform,amir-qayyum-khan/edx-platform,teltek/edx-platform,caesar2164/edx-platform,miptliot/edx-platform,Lektorium-LLC/edx-platform,gsehub/edx-platform,prarthitm/edxplatform,EDUlib/edx-platform,Lektorium-LLC/edx-platform,EDUlib/edx-platform,fintech-circle/edx-platform,edx-solutions/edx-platform,lduarte1991/edx-platform,edx/edx-platform,stvstnfrd/edx-platform,CredoReference/edx-platform,miptliot/edx-platform,gymnasium/edx-platform,romain-li/edx-platform,synergeticsedx/deployment-wipro,msegado/edx-platform,a-parhom/edx-platform,philanthropy-u/edx-platform,pepeportela/edx-platform,eduNEXT/edx-platform,a-parhom/edx-platform,pabloborrego93/edx-platform,appsembler/edx-platform,lduarte1991/edx-platform,philanthropy-u/edx-platform,procangroup/edx-platform,caesar2164/edx-platform,naresh21/synergetics-edx-platform,proversity-org/edx-platform,Edraak/edraak-platform,arbrandes/edx-platform,EDUlib/edx-platform,edx-solutions/edx-platform,jolyonb/edx-platform,msegado/edx-platform,kmoocdev2/edx-platform,raccoongang/edx-platform,cpennington/edx-platform,kmoocdev2/edx-platform,kmoocdev2/edx-platform,a-parhom/edx-platform,angelapper/edx-platform,CredoReference/edx-platform,msegado/edx-platform,msegado/edx-platform,ahmedaljazzar/edx-platform,CredoReference/edx-platform,procangroup/edx-platform
# -*- coding: utf-8 -*- from __future__ import unicode_literals from django.db import migrations, models from openedx.core.djangoapps.xmodule_django.models import CourseKeyField class Migration(migrations.Migration): dependencies = [ ('grades', '0004_visibleblocks_course_id'), ] operations = [ migrations.AlterField( model_name='coursepersistentgradesflag', name='course_id', field=CourseKeyField(max_length=255, db_index=True), ), ] Allow grades app to be zero-migrated
# -*- coding: utf-8 -*- from __future__ import unicode_literals from django.db import migrations, models from openedx.core.djangoapps.xmodule_django.models import CourseKeyField class Migration(migrations.Migration): dependencies = [ ('grades', '0004_visibleblocks_course_id'), ] operations = [ migrations.AlterField( model_name='coursepersistentgradesflag', name='course_id', field=CourseKeyField(max_length=255, db_index=True), ), ] def unapply(self, project_state, schema_editor, collect_sql=False): """ This is a bit of a hack. This migration is removing a unique index that was erroneously included in the initial migrations for this app, so it's very likely that IntegrityErrors would result if we did roll this particular migration back. To avoid this, we override the default unapply method and skip the addition of a unique index that was never intended to exist. The assumption here is that you are never going to be specifically targeting a migration < 0005 for grades, and will only ever be migrating backwards if you intend to go all the way back to zero and drop the tables. If this is not the case and you are reading this comment, please file a PR to help us with your intended usage. """ pass
<commit_before># -*- coding: utf-8 -*- from __future__ import unicode_literals from django.db import migrations, models from openedx.core.djangoapps.xmodule_django.models import CourseKeyField class Migration(migrations.Migration): dependencies = [ ('grades', '0004_visibleblocks_course_id'), ] operations = [ migrations.AlterField( model_name='coursepersistentgradesflag', name='course_id', field=CourseKeyField(max_length=255, db_index=True), ), ] <commit_msg>Allow grades app to be zero-migrated<commit_after>
# -*- coding: utf-8 -*- from __future__ import unicode_literals from django.db import migrations, models from openedx.core.djangoapps.xmodule_django.models import CourseKeyField class Migration(migrations.Migration): dependencies = [ ('grades', '0004_visibleblocks_course_id'), ] operations = [ migrations.AlterField( model_name='coursepersistentgradesflag', name='course_id', field=CourseKeyField(max_length=255, db_index=True), ), ] def unapply(self, project_state, schema_editor, collect_sql=False): """ This is a bit of a hack. This migration is removing a unique index that was erroneously included in the initial migrations for this app, so it's very likely that IntegrityErrors would result if we did roll this particular migration back. To avoid this, we override the default unapply method and skip the addition of a unique index that was never intended to exist. The assumption here is that you are never going to be specifically targeting a migration < 0005 for grades, and will only ever be migrating backwards if you intend to go all the way back to zero and drop the tables. If this is not the case and you are reading this comment, please file a PR to help us with your intended usage. """ pass
# -*- coding: utf-8 -*- from __future__ import unicode_literals from django.db import migrations, models from openedx.core.djangoapps.xmodule_django.models import CourseKeyField class Migration(migrations.Migration): dependencies = [ ('grades', '0004_visibleblocks_course_id'), ] operations = [ migrations.AlterField( model_name='coursepersistentgradesflag', name='course_id', field=CourseKeyField(max_length=255, db_index=True), ), ] Allow grades app to be zero-migrated# -*- coding: utf-8 -*- from __future__ import unicode_literals from django.db import migrations, models from openedx.core.djangoapps.xmodule_django.models import CourseKeyField class Migration(migrations.Migration): dependencies = [ ('grades', '0004_visibleblocks_course_id'), ] operations = [ migrations.AlterField( model_name='coursepersistentgradesflag', name='course_id', field=CourseKeyField(max_length=255, db_index=True), ), ] def unapply(self, project_state, schema_editor, collect_sql=False): """ This is a bit of a hack. This migration is removing a unique index that was erroneously included in the initial migrations for this app, so it's very likely that IntegrityErrors would result if we did roll this particular migration back. To avoid this, we override the default unapply method and skip the addition of a unique index that was never intended to exist. The assumption here is that you are never going to be specifically targeting a migration < 0005 for grades, and will only ever be migrating backwards if you intend to go all the way back to zero and drop the tables. If this is not the case and you are reading this comment, please file a PR to help us with your intended usage. """ pass
<commit_before># -*- coding: utf-8 -*- from __future__ import unicode_literals from django.db import migrations, models from openedx.core.djangoapps.xmodule_django.models import CourseKeyField class Migration(migrations.Migration): dependencies = [ ('grades', '0004_visibleblocks_course_id'), ] operations = [ migrations.AlterField( model_name='coursepersistentgradesflag', name='course_id', field=CourseKeyField(max_length=255, db_index=True), ), ] <commit_msg>Allow grades app to be zero-migrated<commit_after># -*- coding: utf-8 -*- from __future__ import unicode_literals from django.db import migrations, models from openedx.core.djangoapps.xmodule_django.models import CourseKeyField class Migration(migrations.Migration): dependencies = [ ('grades', '0004_visibleblocks_course_id'), ] operations = [ migrations.AlterField( model_name='coursepersistentgradesflag', name='course_id', field=CourseKeyField(max_length=255, db_index=True), ), ] def unapply(self, project_state, schema_editor, collect_sql=False): """ This is a bit of a hack. This migration is removing a unique index that was erroneously included in the initial migrations for this app, so it's very likely that IntegrityErrors would result if we did roll this particular migration back. To avoid this, we override the default unapply method and skip the addition of a unique index that was never intended to exist. The assumption here is that you are never going to be specifically targeting a migration < 0005 for grades, and will only ever be migrating backwards if you intend to go all the way back to zero and drop the tables. If this is not the case and you are reading this comment, please file a PR to help us with your intended usage. """ pass
c7e5306ede3415838c3cf0861c3a1be8caed38ba
mltsp/run_script_in_container.py
mltsp/run_script_in_container.py
#!/usr/bin/python # run_script_in_container.py # Will be run inside Docker container if __name__ == "__main__": # Run Cython setup script: # from subprocess import call # from mltsp import cfg # call(["%s/make" % cfg.PROJECT_PATH]) import argparse parser = argparse.ArgumentParser(description='MLTSP Docker scripts') parser.add_argument('--extract_custom_feats', action='store_true') parser.add_argument('--tmp_dir', dest='tmp_dir', action='store', type=str) args = parser.parse_args() import sys import os sys.path.append(args.tmp_dir) sys.path.append(os.path.join(os.path.dirname(__file__), '..')) if args.extract_custom_feats: from mltsp.docker_scripts import docker_extract_custom_feats docker_extract_custom_feats.extract_custom_feats(args.tmp_dir) else: raise Exception("No valid script parameter passed to " "run_script_in_container")
#!/usr/bin/python # run_script_in_container.py # Will be run inside Docker container if __name__ == "__main__": # Run Cython setup script: # from subprocess import call # from mltsp import cfg # call(["%s/make" % cfg.PROJECT_PATH]) import argparse parser = argparse.ArgumentParser(description='MLTSP Docker scripts') parser.add_argument('--extract_custom_feats', action='store_true') parser.add_argument('--tmp_dir', dest='tmp_dir', action='store', type=str) args = parser.parse_args() import sys import os sys.path.append(args.tmp_dir) # Append mltsp package directory to path so it can be imported below sys.path.append(os.path.join(os.path.dirname(__file__), '..')) if args.extract_custom_feats: from mltsp.docker_scripts import docker_extract_custom_feats docker_extract_custom_feats.extract_custom_feats(args.tmp_dir) else: raise Exception("No valid script parameter passed to " "run_script_in_container")
Add comment explaining path append
Add comment explaining path append
Python
bsd-3-clause
acrellin/mltsp,acrellin/mltsp,mltsp/mltsp,mltsp/mltsp,acrellin/mltsp,acrellin/mltsp,bnaul/mltsp,bnaul/mltsp,mltsp/mltsp,mltsp/mltsp,acrellin/mltsp,acrellin/mltsp,mltsp/mltsp,bnaul/mltsp,bnaul/mltsp,mltsp/mltsp,bnaul/mltsp,bnaul/mltsp
#!/usr/bin/python # run_script_in_container.py # Will be run inside Docker container if __name__ == "__main__": # Run Cython setup script: # from subprocess import call # from mltsp import cfg # call(["%s/make" % cfg.PROJECT_PATH]) import argparse parser = argparse.ArgumentParser(description='MLTSP Docker scripts') parser.add_argument('--extract_custom_feats', action='store_true') parser.add_argument('--tmp_dir', dest='tmp_dir', action='store', type=str) args = parser.parse_args() import sys import os sys.path.append(args.tmp_dir) sys.path.append(os.path.join(os.path.dirname(__file__), '..')) if args.extract_custom_feats: from mltsp.docker_scripts import docker_extract_custom_feats docker_extract_custom_feats.extract_custom_feats(args.tmp_dir) else: raise Exception("No valid script parameter passed to " "run_script_in_container") Add comment explaining path append
#!/usr/bin/python # run_script_in_container.py # Will be run inside Docker container if __name__ == "__main__": # Run Cython setup script: # from subprocess import call # from mltsp import cfg # call(["%s/make" % cfg.PROJECT_PATH]) import argparse parser = argparse.ArgumentParser(description='MLTSP Docker scripts') parser.add_argument('--extract_custom_feats', action='store_true') parser.add_argument('--tmp_dir', dest='tmp_dir', action='store', type=str) args = parser.parse_args() import sys import os sys.path.append(args.tmp_dir) # Append mltsp package directory to path so it can be imported below sys.path.append(os.path.join(os.path.dirname(__file__), '..')) if args.extract_custom_feats: from mltsp.docker_scripts import docker_extract_custom_feats docker_extract_custom_feats.extract_custom_feats(args.tmp_dir) else: raise Exception("No valid script parameter passed to " "run_script_in_container")
<commit_before>#!/usr/bin/python # run_script_in_container.py # Will be run inside Docker container if __name__ == "__main__": # Run Cython setup script: # from subprocess import call # from mltsp import cfg # call(["%s/make" % cfg.PROJECT_PATH]) import argparse parser = argparse.ArgumentParser(description='MLTSP Docker scripts') parser.add_argument('--extract_custom_feats', action='store_true') parser.add_argument('--tmp_dir', dest='tmp_dir', action='store', type=str) args = parser.parse_args() import sys import os sys.path.append(args.tmp_dir) sys.path.append(os.path.join(os.path.dirname(__file__), '..')) if args.extract_custom_feats: from mltsp.docker_scripts import docker_extract_custom_feats docker_extract_custom_feats.extract_custom_feats(args.tmp_dir) else: raise Exception("No valid script parameter passed to " "run_script_in_container") <commit_msg>Add comment explaining path append<commit_after>
#!/usr/bin/python # run_script_in_container.py # Will be run inside Docker container if __name__ == "__main__": # Run Cython setup script: # from subprocess import call # from mltsp import cfg # call(["%s/make" % cfg.PROJECT_PATH]) import argparse parser = argparse.ArgumentParser(description='MLTSP Docker scripts') parser.add_argument('--extract_custom_feats', action='store_true') parser.add_argument('--tmp_dir', dest='tmp_dir', action='store', type=str) args = parser.parse_args() import sys import os sys.path.append(args.tmp_dir) # Append mltsp package directory to path so it can be imported below sys.path.append(os.path.join(os.path.dirname(__file__), '..')) if args.extract_custom_feats: from mltsp.docker_scripts import docker_extract_custom_feats docker_extract_custom_feats.extract_custom_feats(args.tmp_dir) else: raise Exception("No valid script parameter passed to " "run_script_in_container")
#!/usr/bin/python # run_script_in_container.py # Will be run inside Docker container if __name__ == "__main__": # Run Cython setup script: # from subprocess import call # from mltsp import cfg # call(["%s/make" % cfg.PROJECT_PATH]) import argparse parser = argparse.ArgumentParser(description='MLTSP Docker scripts') parser.add_argument('--extract_custom_feats', action='store_true') parser.add_argument('--tmp_dir', dest='tmp_dir', action='store', type=str) args = parser.parse_args() import sys import os sys.path.append(args.tmp_dir) sys.path.append(os.path.join(os.path.dirname(__file__), '..')) if args.extract_custom_feats: from mltsp.docker_scripts import docker_extract_custom_feats docker_extract_custom_feats.extract_custom_feats(args.tmp_dir) else: raise Exception("No valid script parameter passed to " "run_script_in_container") Add comment explaining path append#!/usr/bin/python # run_script_in_container.py # Will be run inside Docker container if __name__ == "__main__": # Run Cython setup script: # from subprocess import call # from mltsp import cfg # call(["%s/make" % cfg.PROJECT_PATH]) import argparse parser = argparse.ArgumentParser(description='MLTSP Docker scripts') parser.add_argument('--extract_custom_feats', action='store_true') parser.add_argument('--tmp_dir', dest='tmp_dir', action='store', type=str) args = parser.parse_args() import sys import os sys.path.append(args.tmp_dir) # Append mltsp package directory to path so it can be imported below sys.path.append(os.path.join(os.path.dirname(__file__), '..')) if args.extract_custom_feats: from mltsp.docker_scripts import docker_extract_custom_feats docker_extract_custom_feats.extract_custom_feats(args.tmp_dir) else: raise Exception("No valid script parameter passed to " "run_script_in_container")
<commit_before>#!/usr/bin/python # run_script_in_container.py # Will be run inside Docker container if __name__ == "__main__": # Run Cython setup script: # from subprocess import call # from mltsp import cfg # call(["%s/make" % cfg.PROJECT_PATH]) import argparse parser = argparse.ArgumentParser(description='MLTSP Docker scripts') parser.add_argument('--extract_custom_feats', action='store_true') parser.add_argument('--tmp_dir', dest='tmp_dir', action='store', type=str) args = parser.parse_args() import sys import os sys.path.append(args.tmp_dir) sys.path.append(os.path.join(os.path.dirname(__file__), '..')) if args.extract_custom_feats: from mltsp.docker_scripts import docker_extract_custom_feats docker_extract_custom_feats.extract_custom_feats(args.tmp_dir) else: raise Exception("No valid script parameter passed to " "run_script_in_container") <commit_msg>Add comment explaining path append<commit_after>#!/usr/bin/python # run_script_in_container.py # Will be run inside Docker container if __name__ == "__main__": # Run Cython setup script: # from subprocess import call # from mltsp import cfg # call(["%s/make" % cfg.PROJECT_PATH]) import argparse parser = argparse.ArgumentParser(description='MLTSP Docker scripts') parser.add_argument('--extract_custom_feats', action='store_true') parser.add_argument('--tmp_dir', dest='tmp_dir', action='store', type=str) args = parser.parse_args() import sys import os sys.path.append(args.tmp_dir) # Append mltsp package directory to path so it can be imported below sys.path.append(os.path.join(os.path.dirname(__file__), '..')) if args.extract_custom_feats: from mltsp.docker_scripts import docker_extract_custom_feats docker_extract_custom_feats.extract_custom_feats(args.tmp_dir) else: raise Exception("No valid script parameter passed to " "run_script_in_container")
497d6169340d96b486e0312288da74646bcc6b1f
website/search/util.py
website/search/util.py
def build_query(q='*', start='0', size='10'): return { 'query': build_query_string(q), 'from': start, 'size': size, } def build_query_string(q): return { 'query_string': { 'default_field': '_all', 'query': q, 'analyze_wildcard': True, 'lenient': True # TODO, may not want to do this } }
def build_query(q='*', start=0, size=10): return { 'query': build_query_string(q), 'from': start, 'size': size, } def build_query_string(q): return { 'query_string': { 'default_field': '_all', 'query': q, 'analyze_wildcard': True, 'lenient': True # TODO, may not want to do this } }
Use index use ints not strings
Use index use ints not strings
Python
apache-2.0
Johnetordoff/osf.io,lyndsysimon/osf.io,asanfilippo7/osf.io,zamattiac/osf.io,samchrisinger/osf.io,crcresearch/osf.io,laurenrevere/osf.io,SSJohns/osf.io,felliott/osf.io,kwierman/osf.io,kushG/osf.io,fabianvf/osf.io,DanielSBrown/osf.io,alexschiller/osf.io,GageGaskins/osf.io,brandonPurvis/osf.io,zamattiac/osf.io,cwisecarver/osf.io,mluo613/osf.io,aaxelb/osf.io,sbt9uc/osf.io,brianjgeiger/osf.io,samanehsan/osf.io,fabianvf/osf.io,ZobairAlijan/osf.io,icereval/osf.io,kch8qx/osf.io,danielneis/osf.io,HarryRybacki/osf.io,himanshuo/osf.io,saradbowman/osf.io,zachjanicki/osf.io,njantrania/osf.io,alexschiller/osf.io,jmcarp/osf.io,CenterForOpenScience/osf.io,barbour-em/osf.io,Johnetordoff/osf.io,jmcarp/osf.io,Ghalko/osf.io,reinaH/osf.io,SSJohns/osf.io,GaryKriebel/osf.io,haoyuchen1992/osf.io,AndrewSallans/osf.io,DanielSBrown/osf.io,petermalcolm/osf.io,jinluyuan/osf.io,caseyrollins/osf.io,sbt9uc/osf.io,caseyrollins/osf.io,jnayak1/osf.io,lamdnhan/osf.io,reinaH/osf.io,dplorimer/osf,KAsante95/osf.io,HalcyonChimera/osf.io,MerlinZhang/osf.io,kushG/osf.io,dplorimer/osf,zachjanicki/osf.io,monikagrabowska/osf.io,arpitar/osf.io,emetsger/osf.io,jnayak1/osf.io,MerlinZhang/osf.io,adlius/osf.io,felliott/osf.io,binoculars/osf.io,samanehsan/osf.io,barbour-em/osf.io,CenterForOpenScience/osf.io,samanehsan/osf.io,caseyrygt/osf.io,himanshuo/osf.io,rdhyee/osf.io,brandonPurvis/osf.io,arpitar/osf.io,kushG/osf.io,chennan47/osf.io,HalcyonChimera/osf.io,zkraime/osf.io,fabianvf/osf.io,KAsante95/osf.io,binoculars/osf.io,brianjgeiger/osf.io,SSJohns/osf.io,cosenal/osf.io,petermalcolm/osf.io,samchrisinger/osf.io,cosenal/osf.io,kwierman/osf.io,cwisecarver/osf.io,TomBaxter/osf.io,emetsger/osf.io,laurenrevere/osf.io,MerlinZhang/osf.io,caseyrollins/osf.io,DanielSBrown/osf.io,wearpants/osf.io,TomBaxter/osf.io,samchrisinger/osf.io,haoyuchen1992/osf.io,kch8qx/osf.io,leb2dg/osf.io,leb2dg/osf.io,jolene-esposito/osf.io,zkraime/osf.io,RomanZWang/osf.io,kch8qx/osf.io,rdhyee/osf.io,cslzchen/osf.io,samanehsan/osf.io,sloria/osf.io,SSJohns/osf.io,acshi/osf.io,jnayak1/osf.io,RomanZWang/osf.io,kwierman/osf.io,njantrania/osf.io,cosenal/osf.io,jmcarp/osf.io,TomHeatwole/osf.io,AndrewSallans/osf.io,GaryKriebel/osf.io,cldershem/osf.io,aaxelb/osf.io,brianjgeiger/osf.io,revanthkolli/osf.io,wearpants/osf.io,felliott/osf.io,CenterForOpenScience/osf.io,jeffreyliu3230/osf.io,hmoco/osf.io,lamdnhan/osf.io,icereval/osf.io,HarryRybacki/osf.io,Ghalko/osf.io,Ghalko/osf.io,jinluyuan/osf.io,jolene-esposito/osf.io,mfraezz/osf.io,mfraezz/osf.io,baylee-d/osf.io,arpitar/osf.io,monikagrabowska/osf.io,CenterForOpenScience/osf.io,jeffreyliu3230/osf.io,asanfilippo7/osf.io,njantrania/osf.io,ckc6cz/osf.io,abought/osf.io,Ghalko/osf.io,ZobairAlijan/osf.io,kch8qx/osf.io,jeffreyliu3230/osf.io,revanthkolli/osf.io,caseyrygt/osf.io,brandonPurvis/osf.io,crcresearch/osf.io,HarryRybacki/osf.io,RomanZWang/osf.io,caseyrygt/osf.io,cldershem/osf.io,emetsger/osf.io,mluo613/osf.io,RomanZWang/osf.io,mfraezz/osf.io,himanshuo/osf.io,cldershem/osf.io,monikagrabowska/osf.io,sbt9uc/osf.io,monikagrabowska/osf.io,dplorimer/osf,amyshi188/osf.io,jmcarp/osf.io,ckc6cz/osf.io,jinluyuan/osf.io,KAsante95/osf.io,zkraime/osf.io,wearpants/osf.io,jnayak1/osf.io,adlius/osf.io,abought/osf.io,lamdnhan/osf.io,pattisdr/osf.io,billyhunt/osf.io,emetsger/osf.io,baylee-d/osf.io,adlius/osf.io,kch8qx/osf.io,lyndsysimon/osf.io,haoyuchen1992/osf.io,TomHeatwole/osf.io,rdhyee/osf.io,njantrania/osf.io,sbt9uc/osf.io,barbour-em/osf.io,chennan47/osf.io,erinspace/osf.io,hmoco/osf.io,caneruguz/osf.io,mattclark/osf.io,mfraezz/osf.io,crcresearch/osf.io,reinaH/osf.io,bdyetton/prettychart,GageGaskins/osf.io,TomHeatwole/osf.io,danielneis/osf.io,ticklemepierce/osf.io,zamattiac/osf.io,abought/osf.io,pattisdr/osf.io,TomHeatwole/osf.io,HalcyonChimera/osf.io,wearpants/osf.io,samchrisinger/osf.io,zamattiac/osf.io,HarryRybacki/osf.io,zachjanicki/osf.io,arpitar/osf.io,alexschiller/osf.io,HalcyonChimera/osf.io,billyhunt/osf.io,GaryKriebel/osf.io,mluo613/osf.io,GageGaskins/osf.io,ckc6cz/osf.io,TomBaxter/osf.io,icereval/osf.io,leb2dg/osf.io,Johnetordoff/osf.io,fabianvf/osf.io,doublebits/osf.io,mluke93/osf.io,mluke93/osf.io,DanielSBrown/osf.io,monikagrabowska/osf.io,erinspace/osf.io,jolene-esposito/osf.io,zachjanicki/osf.io,chrisseto/osf.io,ticklemepierce/osf.io,jinluyuan/osf.io,cslzchen/osf.io,cslzchen/osf.io,revanthkolli/osf.io,ticklemepierce/osf.io,chrisseto/osf.io,kwierman/osf.io,Nesiehr/osf.io,brianjgeiger/osf.io,lamdnhan/osf.io,baylee-d/osf.io,revanthkolli/osf.io,acshi/osf.io,alexschiller/osf.io,Nesiehr/osf.io,haoyuchen1992/osf.io,billyhunt/osf.io,doublebits/osf.io,cldershem/osf.io,bdyetton/prettychart,felliott/osf.io,danielneis/osf.io,GaryKriebel/osf.io,mattclark/osf.io,acshi/osf.io,brandonPurvis/osf.io,doublebits/osf.io,caneruguz/osf.io,bdyetton/prettychart,dplorimer/osf,amyshi188/osf.io,ZobairAlijan/osf.io,aaxelb/osf.io,acshi/osf.io,saradbowman/osf.io,caneruguz/osf.io,GageGaskins/osf.io,asanfilippo7/osf.io,caneruguz/osf.io,Johnetordoff/osf.io,cslzchen/osf.io,jeffreyliu3230/osf.io,mattclark/osf.io,asanfilippo7/osf.io,petermalcolm/osf.io,erinspace/osf.io,doublebits/osf.io,leb2dg/osf.io,adlius/osf.io,ticklemepierce/osf.io,billyhunt/osf.io,lyndsysimon/osf.io,Nesiehr/osf.io,hmoco/osf.io,mluo613/osf.io,chrisseto/osf.io,billyhunt/osf.io,petermalcolm/osf.io,caseyrygt/osf.io,mluke93/osf.io,mluo613/osf.io,KAsante95/osf.io,barbour-em/osf.io,cosenal/osf.io,amyshi188/osf.io,GageGaskins/osf.io,acshi/osf.io,doublebits/osf.io,zkraime/osf.io,brandonPurvis/osf.io,sloria/osf.io,danielneis/osf.io,jolene-esposito/osf.io,RomanZWang/osf.io,reinaH/osf.io,hmoco/osf.io,pattisdr/osf.io,binoculars/osf.io,ZobairAlijan/osf.io,mluke93/osf.io,chennan47/osf.io,MerlinZhang/osf.io,lyndsysimon/osf.io,sloria/osf.io,bdyetton/prettychart,abought/osf.io,Nesiehr/osf.io,chrisseto/osf.io,amyshi188/osf.io,ckc6cz/osf.io,cwisecarver/osf.io,cwisecarver/osf.io,alexschiller/osf.io,himanshuo/osf.io,rdhyee/osf.io,laurenrevere/osf.io,aaxelb/osf.io,KAsante95/osf.io,kushG/osf.io
def build_query(q='*', start='0', size='10'): return { 'query': build_query_string(q), 'from': start, 'size': size, } def build_query_string(q): return { 'query_string': { 'default_field': '_all', 'query': q, 'analyze_wildcard': True, 'lenient': True # TODO, may not want to do this } } Use index use ints not strings
def build_query(q='*', start=0, size=10): return { 'query': build_query_string(q), 'from': start, 'size': size, } def build_query_string(q): return { 'query_string': { 'default_field': '_all', 'query': q, 'analyze_wildcard': True, 'lenient': True # TODO, may not want to do this } }
<commit_before>def build_query(q='*', start='0', size='10'): return { 'query': build_query_string(q), 'from': start, 'size': size, } def build_query_string(q): return { 'query_string': { 'default_field': '_all', 'query': q, 'analyze_wildcard': True, 'lenient': True # TODO, may not want to do this } } <commit_msg>Use index use ints not strings<commit_after>
def build_query(q='*', start=0, size=10): return { 'query': build_query_string(q), 'from': start, 'size': size, } def build_query_string(q): return { 'query_string': { 'default_field': '_all', 'query': q, 'analyze_wildcard': True, 'lenient': True # TODO, may not want to do this } }
def build_query(q='*', start='0', size='10'): return { 'query': build_query_string(q), 'from': start, 'size': size, } def build_query_string(q): return { 'query_string': { 'default_field': '_all', 'query': q, 'analyze_wildcard': True, 'lenient': True # TODO, may not want to do this } } Use index use ints not stringsdef build_query(q='*', start=0, size=10): return { 'query': build_query_string(q), 'from': start, 'size': size, } def build_query_string(q): return { 'query_string': { 'default_field': '_all', 'query': q, 'analyze_wildcard': True, 'lenient': True # TODO, may not want to do this } }
<commit_before>def build_query(q='*', start='0', size='10'): return { 'query': build_query_string(q), 'from': start, 'size': size, } def build_query_string(q): return { 'query_string': { 'default_field': '_all', 'query': q, 'analyze_wildcard': True, 'lenient': True # TODO, may not want to do this } } <commit_msg>Use index use ints not strings<commit_after>def build_query(q='*', start=0, size=10): return { 'query': build_query_string(q), 'from': start, 'size': size, } def build_query_string(q): return { 'query_string': { 'default_field': '_all', 'query': q, 'analyze_wildcard': True, 'lenient': True # TODO, may not want to do this } }
5f332ba0d67607c99feae5af2fea177da588076f
addons/bestja_configuration_ucw/__openerp__.py
addons/bestja_configuration_ucw/__openerp__.py
# -*- coding: utf-8 -*- { 'name': "Bestja: UCW", 'summary': "Installation configuration for UCW", 'description': "Installation configuration for Uniwersyteckie Centrum Wolontariatu", 'author': "Laboratorium EE", 'website': "http://www.laboratorium.ee", 'version': '0.1', 'category': 'Specific Industry Applications', 'depends': [ 'base', 'website_blog', 'bestja_base', 'bestja_volunteer', 'bestja_volunteer_notes', 'bestja_account_deletion', 'bestja_organization', 'bestja_project', 'bestja_offers', 'bestja_offers_moderation', 'bestja_offers_invitations', 'bestja_offers_categorization', 'bestja_files', 'bestja_application_moderation', 'bestja_ucw_permissions', ], 'data': [ 'data.xml', ], 'application': True, }
# -*- coding: utf-8 -*- { 'name': "Bestja: UCW", 'summary': "Installation configuration for UCW", 'description': "Installation configuration for Uniwersyteckie Centrum Wolontariatu", 'author': "Laboratorium EE", 'website': "http://www.laboratorium.ee", 'version': '0.1', 'category': 'Specific Industry Applications', 'depends': [ 'base', 'bestja_base', 'bestja_volunteer', 'bestja_volunteer_notes', 'bestja_account_deletion', 'bestja_organization', 'bestja_project', 'bestja_offers', 'bestja_offers_moderation', 'bestja_offers_invitations', 'bestja_offers_categorization', 'bestja_files', 'bestja_application_moderation', 'bestja_ucw_permissions', ], 'data': [ 'data.xml', ], 'application': True, }
Revert “Enable Odoo blog for UCW”
Revert “Enable Odoo blog for UCW” This reverts commit 4922d53f95b3f7c055afe1d0af0088b505cbc0d2.
Python
agpl-3.0
KamilWo/bestja,KrzysiekJ/bestja,KrzysiekJ/bestja,EE/bestja,EE/bestja,ludwiktrammer/bestja,ludwiktrammer/bestja,EE/bestja,KamilWo/bestja,KamilWo/bestja,ludwiktrammer/bestja,KrzysiekJ/bestja
# -*- coding: utf-8 -*- { 'name': "Bestja: UCW", 'summary': "Installation configuration for UCW", 'description': "Installation configuration for Uniwersyteckie Centrum Wolontariatu", 'author': "Laboratorium EE", 'website': "http://www.laboratorium.ee", 'version': '0.1', 'category': 'Specific Industry Applications', 'depends': [ 'base', 'website_blog', 'bestja_base', 'bestja_volunteer', 'bestja_volunteer_notes', 'bestja_account_deletion', 'bestja_organization', 'bestja_project', 'bestja_offers', 'bestja_offers_moderation', 'bestja_offers_invitations', 'bestja_offers_categorization', 'bestja_files', 'bestja_application_moderation', 'bestja_ucw_permissions', ], 'data': [ 'data.xml', ], 'application': True, } Revert “Enable Odoo blog for UCW” This reverts commit 4922d53f95b3f7c055afe1d0af0088b505cbc0d2.
# -*- coding: utf-8 -*- { 'name': "Bestja: UCW", 'summary': "Installation configuration for UCW", 'description': "Installation configuration for Uniwersyteckie Centrum Wolontariatu", 'author': "Laboratorium EE", 'website': "http://www.laboratorium.ee", 'version': '0.1', 'category': 'Specific Industry Applications', 'depends': [ 'base', 'bestja_base', 'bestja_volunteer', 'bestja_volunteer_notes', 'bestja_account_deletion', 'bestja_organization', 'bestja_project', 'bestja_offers', 'bestja_offers_moderation', 'bestja_offers_invitations', 'bestja_offers_categorization', 'bestja_files', 'bestja_application_moderation', 'bestja_ucw_permissions', ], 'data': [ 'data.xml', ], 'application': True, }
<commit_before># -*- coding: utf-8 -*- { 'name': "Bestja: UCW", 'summary': "Installation configuration for UCW", 'description': "Installation configuration for Uniwersyteckie Centrum Wolontariatu", 'author': "Laboratorium EE", 'website': "http://www.laboratorium.ee", 'version': '0.1', 'category': 'Specific Industry Applications', 'depends': [ 'base', 'website_blog', 'bestja_base', 'bestja_volunteer', 'bestja_volunteer_notes', 'bestja_account_deletion', 'bestja_organization', 'bestja_project', 'bestja_offers', 'bestja_offers_moderation', 'bestja_offers_invitations', 'bestja_offers_categorization', 'bestja_files', 'bestja_application_moderation', 'bestja_ucw_permissions', ], 'data': [ 'data.xml', ], 'application': True, } <commit_msg>Revert “Enable Odoo blog for UCW” This reverts commit 4922d53f95b3f7c055afe1d0af0088b505cbc0d2.<commit_after>
# -*- coding: utf-8 -*- { 'name': "Bestja: UCW", 'summary': "Installation configuration for UCW", 'description': "Installation configuration for Uniwersyteckie Centrum Wolontariatu", 'author': "Laboratorium EE", 'website': "http://www.laboratorium.ee", 'version': '0.1', 'category': 'Specific Industry Applications', 'depends': [ 'base', 'bestja_base', 'bestja_volunteer', 'bestja_volunteer_notes', 'bestja_account_deletion', 'bestja_organization', 'bestja_project', 'bestja_offers', 'bestja_offers_moderation', 'bestja_offers_invitations', 'bestja_offers_categorization', 'bestja_files', 'bestja_application_moderation', 'bestja_ucw_permissions', ], 'data': [ 'data.xml', ], 'application': True, }
# -*- coding: utf-8 -*- { 'name': "Bestja: UCW", 'summary': "Installation configuration for UCW", 'description': "Installation configuration for Uniwersyteckie Centrum Wolontariatu", 'author': "Laboratorium EE", 'website': "http://www.laboratorium.ee", 'version': '0.1', 'category': 'Specific Industry Applications', 'depends': [ 'base', 'website_blog', 'bestja_base', 'bestja_volunteer', 'bestja_volunteer_notes', 'bestja_account_deletion', 'bestja_organization', 'bestja_project', 'bestja_offers', 'bestja_offers_moderation', 'bestja_offers_invitations', 'bestja_offers_categorization', 'bestja_files', 'bestja_application_moderation', 'bestja_ucw_permissions', ], 'data': [ 'data.xml', ], 'application': True, } Revert “Enable Odoo blog for UCW” This reverts commit 4922d53f95b3f7c055afe1d0af0088b505cbc0d2.# -*- coding: utf-8 -*- { 'name': "Bestja: UCW", 'summary': "Installation configuration for UCW", 'description': "Installation configuration for Uniwersyteckie Centrum Wolontariatu", 'author': "Laboratorium EE", 'website': "http://www.laboratorium.ee", 'version': '0.1', 'category': 'Specific Industry Applications', 'depends': [ 'base', 'bestja_base', 'bestja_volunteer', 'bestja_volunteer_notes', 'bestja_account_deletion', 'bestja_organization', 'bestja_project', 'bestja_offers', 'bestja_offers_moderation', 'bestja_offers_invitations', 'bestja_offers_categorization', 'bestja_files', 'bestja_application_moderation', 'bestja_ucw_permissions', ], 'data': [ 'data.xml', ], 'application': True, }
<commit_before># -*- coding: utf-8 -*- { 'name': "Bestja: UCW", 'summary': "Installation configuration for UCW", 'description': "Installation configuration for Uniwersyteckie Centrum Wolontariatu", 'author': "Laboratorium EE", 'website': "http://www.laboratorium.ee", 'version': '0.1', 'category': 'Specific Industry Applications', 'depends': [ 'base', 'website_blog', 'bestja_base', 'bestja_volunteer', 'bestja_volunteer_notes', 'bestja_account_deletion', 'bestja_organization', 'bestja_project', 'bestja_offers', 'bestja_offers_moderation', 'bestja_offers_invitations', 'bestja_offers_categorization', 'bestja_files', 'bestja_application_moderation', 'bestja_ucw_permissions', ], 'data': [ 'data.xml', ], 'application': True, } <commit_msg>Revert “Enable Odoo blog for UCW” This reverts commit 4922d53f95b3f7c055afe1d0af0088b505cbc0d2.<commit_after># -*- coding: utf-8 -*- { 'name': "Bestja: UCW", 'summary': "Installation configuration for UCW", 'description': "Installation configuration for Uniwersyteckie Centrum Wolontariatu", 'author': "Laboratorium EE", 'website': "http://www.laboratorium.ee", 'version': '0.1', 'category': 'Specific Industry Applications', 'depends': [ 'base', 'bestja_base', 'bestja_volunteer', 'bestja_volunteer_notes', 'bestja_account_deletion', 'bestja_organization', 'bestja_project', 'bestja_offers', 'bestja_offers_moderation', 'bestja_offers_invitations', 'bestja_offers_categorization', 'bestja_files', 'bestja_application_moderation', 'bestja_ucw_permissions', ], 'data': [ 'data.xml', ], 'application': True, }
3178a77cc6cdefeaacafbacf91c8b35308c18170
setup.py
setup.py
from setuptools import setup, find_packages version = '0.2' README = open("README.rst", "rt").read() setup(name='corneti.recipes.codeintel', version=version, description="A Sublime Text 2 / SublimeCodeIntel auto-completion data generator for buildout", long_description=README, classifiers=[ 'Development Status :: 4 - Beta', 'Environment :: Console', 'Framework :: Buildout', 'Framework :: Buildout :: Recipe', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Text Editors' ], keywords='sublimetext sublimecodeintel editor buildout recipe', author='Fabio Corneti', author_email='[email protected]', url='https://github.com/fabiocorneti/corneti.recipes.codeintel', license='MIT', packages=find_packages(exclude=['ez_setup']), namespace_packages=['corneti', 'corneti.recipes'], include_package_data=True, zip_safe=False, install_requires=['setuptools', 'zc.buildout', 'zc.recipe.egg'], entry_points={'zc.buildout': ['default = corneti.recipes.codeintel:CodeintelRecipe']}, )
from setuptools import setup, find_packages version = '0.2.1' README = open("README.rst", "rt").read() setup(name='corneti.recipes.codeintel', version=version, description="A Sublime Text 2 / SublimeCodeIntel auto-completion data generator for buildout", long_description=README, classifiers=[ 'Development Status :: 4 - Beta', 'Environment :: Console', 'Framework :: Buildout', 'Framework :: Buildout :: Recipe', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Text Editors' ], keywords='sublimetext sublimecodeintel editor buildout recipe', author='Fabio Corneti', author_email='[email protected]', url='https://github.com/fabiocorneti/corneti.recipes.codeintel', license='MIT', packages=find_packages(exclude=['ez_setup']), namespace_packages=['corneti', 'corneti.recipes'], include_package_data=True, zip_safe=False, install_requires=['setuptools', 'zc.buildout', 'zc.recipe.egg'], entry_points={'zc.buildout': ['default = corneti.recipes.codeintel:CodeintelRecipe']}, )
Include documentation and license in package
Include documentation and license in package
Python
mit
fabiocorneti/corneti.recipes.codeintel
from setuptools import setup, find_packages version = '0.2' README = open("README.rst", "rt").read() setup(name='corneti.recipes.codeintel', version=version, description="A Sublime Text 2 / SublimeCodeIntel auto-completion data generator for buildout", long_description=README, classifiers=[ 'Development Status :: 4 - Beta', 'Environment :: Console', 'Framework :: Buildout', 'Framework :: Buildout :: Recipe', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Text Editors' ], keywords='sublimetext sublimecodeintel editor buildout recipe', author='Fabio Corneti', author_email='[email protected]', url='https://github.com/fabiocorneti/corneti.recipes.codeintel', license='MIT', packages=find_packages(exclude=['ez_setup']), namespace_packages=['corneti', 'corneti.recipes'], include_package_data=True, zip_safe=False, install_requires=['setuptools', 'zc.buildout', 'zc.recipe.egg'], entry_points={'zc.buildout': ['default = corneti.recipes.codeintel:CodeintelRecipe']}, ) Include documentation and license in package
from setuptools import setup, find_packages version = '0.2.1' README = open("README.rst", "rt").read() setup(name='corneti.recipes.codeintel', version=version, description="A Sublime Text 2 / SublimeCodeIntel auto-completion data generator for buildout", long_description=README, classifiers=[ 'Development Status :: 4 - Beta', 'Environment :: Console', 'Framework :: Buildout', 'Framework :: Buildout :: Recipe', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Text Editors' ], keywords='sublimetext sublimecodeintel editor buildout recipe', author='Fabio Corneti', author_email='[email protected]', url='https://github.com/fabiocorneti/corneti.recipes.codeintel', license='MIT', packages=find_packages(exclude=['ez_setup']), namespace_packages=['corneti', 'corneti.recipes'], include_package_data=True, zip_safe=False, install_requires=['setuptools', 'zc.buildout', 'zc.recipe.egg'], entry_points={'zc.buildout': ['default = corneti.recipes.codeintel:CodeintelRecipe']}, )
<commit_before>from setuptools import setup, find_packages version = '0.2' README = open("README.rst", "rt").read() setup(name='corneti.recipes.codeintel', version=version, description="A Sublime Text 2 / SublimeCodeIntel auto-completion data generator for buildout", long_description=README, classifiers=[ 'Development Status :: 4 - Beta', 'Environment :: Console', 'Framework :: Buildout', 'Framework :: Buildout :: Recipe', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Text Editors' ], keywords='sublimetext sublimecodeintel editor buildout recipe', author='Fabio Corneti', author_email='[email protected]', url='https://github.com/fabiocorneti/corneti.recipes.codeintel', license='MIT', packages=find_packages(exclude=['ez_setup']), namespace_packages=['corneti', 'corneti.recipes'], include_package_data=True, zip_safe=False, install_requires=['setuptools', 'zc.buildout', 'zc.recipe.egg'], entry_points={'zc.buildout': ['default = corneti.recipes.codeintel:CodeintelRecipe']}, ) <commit_msg>Include documentation and license in package<commit_after>
from setuptools import setup, find_packages version = '0.2.1' README = open("README.rst", "rt").read() setup(name='corneti.recipes.codeintel', version=version, description="A Sublime Text 2 / SublimeCodeIntel auto-completion data generator for buildout", long_description=README, classifiers=[ 'Development Status :: 4 - Beta', 'Environment :: Console', 'Framework :: Buildout', 'Framework :: Buildout :: Recipe', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Text Editors' ], keywords='sublimetext sublimecodeintel editor buildout recipe', author='Fabio Corneti', author_email='[email protected]', url='https://github.com/fabiocorneti/corneti.recipes.codeintel', license='MIT', packages=find_packages(exclude=['ez_setup']), namespace_packages=['corneti', 'corneti.recipes'], include_package_data=True, zip_safe=False, install_requires=['setuptools', 'zc.buildout', 'zc.recipe.egg'], entry_points={'zc.buildout': ['default = corneti.recipes.codeintel:CodeintelRecipe']}, )
from setuptools import setup, find_packages version = '0.2' README = open("README.rst", "rt").read() setup(name='corneti.recipes.codeintel', version=version, description="A Sublime Text 2 / SublimeCodeIntel auto-completion data generator for buildout", long_description=README, classifiers=[ 'Development Status :: 4 - Beta', 'Environment :: Console', 'Framework :: Buildout', 'Framework :: Buildout :: Recipe', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Text Editors' ], keywords='sublimetext sublimecodeintel editor buildout recipe', author='Fabio Corneti', author_email='[email protected]', url='https://github.com/fabiocorneti/corneti.recipes.codeintel', license='MIT', packages=find_packages(exclude=['ez_setup']), namespace_packages=['corneti', 'corneti.recipes'], include_package_data=True, zip_safe=False, install_requires=['setuptools', 'zc.buildout', 'zc.recipe.egg'], entry_points={'zc.buildout': ['default = corneti.recipes.codeintel:CodeintelRecipe']}, ) Include documentation and license in packagefrom setuptools import setup, find_packages version = '0.2.1' README = open("README.rst", "rt").read() setup(name='corneti.recipes.codeintel', version=version, description="A Sublime Text 2 / SublimeCodeIntel auto-completion data generator for buildout", long_description=README, classifiers=[ 'Development Status :: 4 - Beta', 'Environment :: Console', 'Framework :: Buildout', 'Framework :: Buildout :: Recipe', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Text Editors' ], keywords='sublimetext sublimecodeintel editor buildout recipe', author='Fabio Corneti', author_email='[email protected]', url='https://github.com/fabiocorneti/corneti.recipes.codeintel', license='MIT', packages=find_packages(exclude=['ez_setup']), namespace_packages=['corneti', 'corneti.recipes'], include_package_data=True, zip_safe=False, install_requires=['setuptools', 'zc.buildout', 'zc.recipe.egg'], entry_points={'zc.buildout': ['default = corneti.recipes.codeintel:CodeintelRecipe']}, )
<commit_before>from setuptools import setup, find_packages version = '0.2' README = open("README.rst", "rt").read() setup(name='corneti.recipes.codeintel', version=version, description="A Sublime Text 2 / SublimeCodeIntel auto-completion data generator for buildout", long_description=README, classifiers=[ 'Development Status :: 4 - Beta', 'Environment :: Console', 'Framework :: Buildout', 'Framework :: Buildout :: Recipe', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Text Editors' ], keywords='sublimetext sublimecodeintel editor buildout recipe', author='Fabio Corneti', author_email='[email protected]', url='https://github.com/fabiocorneti/corneti.recipes.codeintel', license='MIT', packages=find_packages(exclude=['ez_setup']), namespace_packages=['corneti', 'corneti.recipes'], include_package_data=True, zip_safe=False, install_requires=['setuptools', 'zc.buildout', 'zc.recipe.egg'], entry_points={'zc.buildout': ['default = corneti.recipes.codeintel:CodeintelRecipe']}, ) <commit_msg>Include documentation and license in package<commit_after>from setuptools import setup, find_packages version = '0.2.1' README = open("README.rst", "rt").read() setup(name='corneti.recipes.codeintel', version=version, description="A Sublime Text 2 / SublimeCodeIntel auto-completion data generator for buildout", long_description=README, classifiers=[ 'Development Status :: 4 - Beta', 'Environment :: Console', 'Framework :: Buildout', 'Framework :: Buildout :: Recipe', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Text Editors' ], keywords='sublimetext sublimecodeintel editor buildout recipe', author='Fabio Corneti', author_email='[email protected]', url='https://github.com/fabiocorneti/corneti.recipes.codeintel', license='MIT', packages=find_packages(exclude=['ez_setup']), namespace_packages=['corneti', 'corneti.recipes'], include_package_data=True, zip_safe=False, install_requires=['setuptools', 'zc.buildout', 'zc.recipe.egg'], entry_points={'zc.buildout': ['default = corneti.recipes.codeintel:CodeintelRecipe']}, )
ba7109a6b95ee88e4890752fdf7a878f3c45bac8
setup.py
setup.py
from setuptools import setup, find_packages setup( name='dataset', version='0.3.14', description="Toolkit for Python-based data processing.", long_description="", classifiers=[ "Development Status :: 3 - Alpha", "Intended Audience :: Developers", "License :: OSI Approved :: MIT License", "Operating System :: OS Independent", "Programming Language :: Python", ], keywords='sql sqlalchemy etl loading utility', author='Friedrich Lindenberg, Gregor Aisch', author_email='[email protected]', url='http://github.com/pudo/dataset', license='MIT', packages=find_packages(exclude=['ez_setup', 'examples', 'tests']), namespace_packages=[], include_package_data=False, zip_safe=False, install_requires=[ 'sqlalchemy >= 0.8.1', 'alembic >= 0.6.1', "argparse >= 1.2.1", 'python-slugify >= 0.0.6', "PyYAML >= 3.10" ], tests_require=[], entry_points={ 'console_scripts': [ 'datafreeze = dataset.freeze.app:main', ] } )
from setuptools import setup, find_packages setup( name='dataset', version='0.3.14', description="Toolkit for Python-based data processing.", long_description="", classifiers=[ "Development Status :: 3 - Alpha", "Intended Audience :: Developers", "License :: OSI Approved :: MIT License", "Operating System :: OS Independent", 'Programming Language :: Python :: 2.6', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3.3' ], keywords='sql sqlalchemy etl loading utility', author='Friedrich Lindenberg, Gregor Aisch', author_email='[email protected]', url='http://github.com/pudo/dataset', license='MIT', packages=find_packages(exclude=['ez_setup', 'examples', 'tests']), namespace_packages=[], include_package_data=False, zip_safe=False, install_requires=[ 'sqlalchemy >= 0.8.1', 'alembic >= 0.6.1', "argparse >= 1.2.1", 'python-slugify >= 0.0.6', "PyYAML >= 3.10" ], tests_require=[], entry_points={ 'console_scripts': [ 'datafreeze = dataset.freeze.app:main', ] } )
Add Py 2 and Py 3 classifiers
Add Py 2 and Py 3 classifiers
Python
mit
reubano/dataset,vguzmanp/dataset,stefanw/dataset,pudo/dataset,saimn/dataset,twds/dataset,askebos/dataset
from setuptools import setup, find_packages setup( name='dataset', version='0.3.14', description="Toolkit for Python-based data processing.", long_description="", classifiers=[ "Development Status :: 3 - Alpha", "Intended Audience :: Developers", "License :: OSI Approved :: MIT License", "Operating System :: OS Independent", "Programming Language :: Python", ], keywords='sql sqlalchemy etl loading utility', author='Friedrich Lindenberg, Gregor Aisch', author_email='[email protected]', url='http://github.com/pudo/dataset', license='MIT', packages=find_packages(exclude=['ez_setup', 'examples', 'tests']), namespace_packages=[], include_package_data=False, zip_safe=False, install_requires=[ 'sqlalchemy >= 0.8.1', 'alembic >= 0.6.1', "argparse >= 1.2.1", 'python-slugify >= 0.0.6', "PyYAML >= 3.10" ], tests_require=[], entry_points={ 'console_scripts': [ 'datafreeze = dataset.freeze.app:main', ] } ) Add Py 2 and Py 3 classifiers
from setuptools import setup, find_packages setup( name='dataset', version='0.3.14', description="Toolkit for Python-based data processing.", long_description="", classifiers=[ "Development Status :: 3 - Alpha", "Intended Audience :: Developers", "License :: OSI Approved :: MIT License", "Operating System :: OS Independent", 'Programming Language :: Python :: 2.6', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3.3' ], keywords='sql sqlalchemy etl loading utility', author='Friedrich Lindenberg, Gregor Aisch', author_email='[email protected]', url='http://github.com/pudo/dataset', license='MIT', packages=find_packages(exclude=['ez_setup', 'examples', 'tests']), namespace_packages=[], include_package_data=False, zip_safe=False, install_requires=[ 'sqlalchemy >= 0.8.1', 'alembic >= 0.6.1', "argparse >= 1.2.1", 'python-slugify >= 0.0.6', "PyYAML >= 3.10" ], tests_require=[], entry_points={ 'console_scripts': [ 'datafreeze = dataset.freeze.app:main', ] } )
<commit_before>from setuptools import setup, find_packages setup( name='dataset', version='0.3.14', description="Toolkit for Python-based data processing.", long_description="", classifiers=[ "Development Status :: 3 - Alpha", "Intended Audience :: Developers", "License :: OSI Approved :: MIT License", "Operating System :: OS Independent", "Programming Language :: Python", ], keywords='sql sqlalchemy etl loading utility', author='Friedrich Lindenberg, Gregor Aisch', author_email='[email protected]', url='http://github.com/pudo/dataset', license='MIT', packages=find_packages(exclude=['ez_setup', 'examples', 'tests']), namespace_packages=[], include_package_data=False, zip_safe=False, install_requires=[ 'sqlalchemy >= 0.8.1', 'alembic >= 0.6.1', "argparse >= 1.2.1", 'python-slugify >= 0.0.6', "PyYAML >= 3.10" ], tests_require=[], entry_points={ 'console_scripts': [ 'datafreeze = dataset.freeze.app:main', ] } ) <commit_msg>Add Py 2 and Py 3 classifiers<commit_after>
from setuptools import setup, find_packages setup( name='dataset', version='0.3.14', description="Toolkit for Python-based data processing.", long_description="", classifiers=[ "Development Status :: 3 - Alpha", "Intended Audience :: Developers", "License :: OSI Approved :: MIT License", "Operating System :: OS Independent", 'Programming Language :: Python :: 2.6', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3.3' ], keywords='sql sqlalchemy etl loading utility', author='Friedrich Lindenberg, Gregor Aisch', author_email='[email protected]', url='http://github.com/pudo/dataset', license='MIT', packages=find_packages(exclude=['ez_setup', 'examples', 'tests']), namespace_packages=[], include_package_data=False, zip_safe=False, install_requires=[ 'sqlalchemy >= 0.8.1', 'alembic >= 0.6.1', "argparse >= 1.2.1", 'python-slugify >= 0.0.6', "PyYAML >= 3.10" ], tests_require=[], entry_points={ 'console_scripts': [ 'datafreeze = dataset.freeze.app:main', ] } )
from setuptools import setup, find_packages setup( name='dataset', version='0.3.14', description="Toolkit for Python-based data processing.", long_description="", classifiers=[ "Development Status :: 3 - Alpha", "Intended Audience :: Developers", "License :: OSI Approved :: MIT License", "Operating System :: OS Independent", "Programming Language :: Python", ], keywords='sql sqlalchemy etl loading utility', author='Friedrich Lindenberg, Gregor Aisch', author_email='[email protected]', url='http://github.com/pudo/dataset', license='MIT', packages=find_packages(exclude=['ez_setup', 'examples', 'tests']), namespace_packages=[], include_package_data=False, zip_safe=False, install_requires=[ 'sqlalchemy >= 0.8.1', 'alembic >= 0.6.1', "argparse >= 1.2.1", 'python-slugify >= 0.0.6', "PyYAML >= 3.10" ], tests_require=[], entry_points={ 'console_scripts': [ 'datafreeze = dataset.freeze.app:main', ] } ) Add Py 2 and Py 3 classifiersfrom setuptools import setup, find_packages setup( name='dataset', version='0.3.14', description="Toolkit for Python-based data processing.", long_description="", classifiers=[ "Development Status :: 3 - Alpha", "Intended Audience :: Developers", "License :: OSI Approved :: MIT License", "Operating System :: OS Independent", 'Programming Language :: Python :: 2.6', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3.3' ], keywords='sql sqlalchemy etl loading utility', author='Friedrich Lindenberg, Gregor Aisch', author_email='[email protected]', url='http://github.com/pudo/dataset', license='MIT', packages=find_packages(exclude=['ez_setup', 'examples', 'tests']), namespace_packages=[], include_package_data=False, zip_safe=False, install_requires=[ 'sqlalchemy >= 0.8.1', 'alembic >= 0.6.1', "argparse >= 1.2.1", 'python-slugify >= 0.0.6', "PyYAML >= 3.10" ], tests_require=[], entry_points={ 'console_scripts': [ 'datafreeze = dataset.freeze.app:main', ] } )
<commit_before>from setuptools import setup, find_packages setup( name='dataset', version='0.3.14', description="Toolkit for Python-based data processing.", long_description="", classifiers=[ "Development Status :: 3 - Alpha", "Intended Audience :: Developers", "License :: OSI Approved :: MIT License", "Operating System :: OS Independent", "Programming Language :: Python", ], keywords='sql sqlalchemy etl loading utility', author='Friedrich Lindenberg, Gregor Aisch', author_email='[email protected]', url='http://github.com/pudo/dataset', license='MIT', packages=find_packages(exclude=['ez_setup', 'examples', 'tests']), namespace_packages=[], include_package_data=False, zip_safe=False, install_requires=[ 'sqlalchemy >= 0.8.1', 'alembic >= 0.6.1', "argparse >= 1.2.1", 'python-slugify >= 0.0.6', "PyYAML >= 3.10" ], tests_require=[], entry_points={ 'console_scripts': [ 'datafreeze = dataset.freeze.app:main', ] } ) <commit_msg>Add Py 2 and Py 3 classifiers<commit_after>from setuptools import setup, find_packages setup( name='dataset', version='0.3.14', description="Toolkit for Python-based data processing.", long_description="", classifiers=[ "Development Status :: 3 - Alpha", "Intended Audience :: Developers", "License :: OSI Approved :: MIT License", "Operating System :: OS Independent", 'Programming Language :: Python :: 2.6', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3.3' ], keywords='sql sqlalchemy etl loading utility', author='Friedrich Lindenberg, Gregor Aisch', author_email='[email protected]', url='http://github.com/pudo/dataset', license='MIT', packages=find_packages(exclude=['ez_setup', 'examples', 'tests']), namespace_packages=[], include_package_data=False, zip_safe=False, install_requires=[ 'sqlalchemy >= 0.8.1', 'alembic >= 0.6.1', "argparse >= 1.2.1", 'python-slugify >= 0.0.6', "PyYAML >= 3.10" ], tests_require=[], entry_points={ 'console_scripts': [ 'datafreeze = dataset.freeze.app:main', ] } )
bf39da891857771cdb51a2ff141b1200950084ad
setup.py
setup.py
#!/usr/bin/env python import sys from setuptools import setup from setuptools.command.test import test as TestCommand import nacl try: import nacl.nacl except ImportError: # installing - there is no cffi yet ext_modules = [] else: # building bdist - cffi is here! ext_modules = [nacl.nacl.ffi.verifier.get_extension()] class PyTest(TestCommand): def finalize_options(self): TestCommand.finalize_options(self) self.test_args = [] self.test_suite = True def run_tests(self): import pytest errno = pytest.main(self.test_args) sys.exit(errno) setup( name=nacl.__title__, version=nacl.__version__, description=nacl.__summary__, long_description=open("README.rst").read(), url=nacl.__uri__, license=nacl.__license__, author=nacl.__author__, author_email=nacl.__email__, install_requires=[ "cffi", ], extras_require={ "tests": ["pytest"], }, tests_require=["pytest"], packages=[ "nacl", "nacl.invoke", ], ext_package="nacl", ext_modules=ext_modules, zip_safe=False, cmdclass={"test": PyTest}, )
#!/usr/bin/env python import sys from setuptools import setup from setuptools.command.test import test as TestCommand import nacl try: import nacl.nacl except ImportError: # installing - there is no cffi yet ext_modules = [] else: # building bdist - cffi is here! ext_modules = [nacl.nacl.ffi.verifier.get_extension()] class PyTest(TestCommand): def finalize_options(self): TestCommand.finalize_options(self) self.test_args = [] self.test_suite = True def run_tests(self): import pytest errno = pytest.main(self.test_args) sys.exit(errno) setup( name=nacl.__title__, version=nacl.__version__, description=nacl.__summary__, long_description=open("README.rst").read(), url=nacl.__uri__, license=nacl.__license__, author=nacl.__author__, author_email=nacl.__email__, install_requires=[ "cffi", ], extras_require={ "tests": ["pytest"], }, tests_require=["pytest"], packages=[ "nacl", "nacl.invoke", ], ext_package="nacl", ext_modules=ext_modules, zip_safe=False, cmdclass={"test": PyTest}, classifiers=[ "Programming Language :: Python :: Implementation :: CPython", "Programming Language :: Python :: Implementation :: PyPy", "Programming Language :: Python :: 2", "Programming Language :: Python :: 2.6", "Programming Language :: Python :: 2.7", "Programming Language :: Python :: 3", "Programming Language :: Python :: 3.2", "Programming Language :: Python :: 3.3", ] )
Add clasifiers for the Python implementations and versions
Add clasifiers for the Python implementations and versions
Python
apache-2.0
dstufft/pynacl,alex/pynacl,lmctv/pynacl,lmctv/pynacl,pyca/pynacl,reaperhulk/pynacl,dstufft/pynacl,ucoin-io/cutecoin,reaperhulk/pynacl,hoffmabc/pynacl,reaperhulk/pynacl,pyca/pynacl,reaperhulk/pynacl,scholarly/pynacl,reaperhulk/pynacl,xueyumusic/pynacl,dstufft/pynacl,xueyumusic/pynacl,hoffmabc/pynacl,dstufft/pynacl,scholarly/pynacl,alex/pynacl,lmctv/pynacl,scholarly/pynacl,alex/pynacl,xueyumusic/pynacl,lmctv/pynacl,ucoin-bot/cutecoin,xueyumusic/pynacl,pyca/pynacl,lmctv/pynacl,Insoleet/cutecoin,ucoin-io/cutecoin,JackWink/pynacl,pyca/pynacl,ucoin-io/cutecoin,pyca/pynacl,JackWink/pynacl,JackWink/pynacl,alex/pynacl,hoffmabc/pynacl,scholarly/pynacl,JackWink/pynacl
#!/usr/bin/env python import sys from setuptools import setup from setuptools.command.test import test as TestCommand import nacl try: import nacl.nacl except ImportError: # installing - there is no cffi yet ext_modules = [] else: # building bdist - cffi is here! ext_modules = [nacl.nacl.ffi.verifier.get_extension()] class PyTest(TestCommand): def finalize_options(self): TestCommand.finalize_options(self) self.test_args = [] self.test_suite = True def run_tests(self): import pytest errno = pytest.main(self.test_args) sys.exit(errno) setup( name=nacl.__title__, version=nacl.__version__, description=nacl.__summary__, long_description=open("README.rst").read(), url=nacl.__uri__, license=nacl.__license__, author=nacl.__author__, author_email=nacl.__email__, install_requires=[ "cffi", ], extras_require={ "tests": ["pytest"], }, tests_require=["pytest"], packages=[ "nacl", "nacl.invoke", ], ext_package="nacl", ext_modules=ext_modules, zip_safe=False, cmdclass={"test": PyTest}, ) Add clasifiers for the Python implementations and versions
#!/usr/bin/env python import sys from setuptools import setup from setuptools.command.test import test as TestCommand import nacl try: import nacl.nacl except ImportError: # installing - there is no cffi yet ext_modules = [] else: # building bdist - cffi is here! ext_modules = [nacl.nacl.ffi.verifier.get_extension()] class PyTest(TestCommand): def finalize_options(self): TestCommand.finalize_options(self) self.test_args = [] self.test_suite = True def run_tests(self): import pytest errno = pytest.main(self.test_args) sys.exit(errno) setup( name=nacl.__title__, version=nacl.__version__, description=nacl.__summary__, long_description=open("README.rst").read(), url=nacl.__uri__, license=nacl.__license__, author=nacl.__author__, author_email=nacl.__email__, install_requires=[ "cffi", ], extras_require={ "tests": ["pytest"], }, tests_require=["pytest"], packages=[ "nacl", "nacl.invoke", ], ext_package="nacl", ext_modules=ext_modules, zip_safe=False, cmdclass={"test": PyTest}, classifiers=[ "Programming Language :: Python :: Implementation :: CPython", "Programming Language :: Python :: Implementation :: PyPy", "Programming Language :: Python :: 2", "Programming Language :: Python :: 2.6", "Programming Language :: Python :: 2.7", "Programming Language :: Python :: 3", "Programming Language :: Python :: 3.2", "Programming Language :: Python :: 3.3", ] )
<commit_before>#!/usr/bin/env python import sys from setuptools import setup from setuptools.command.test import test as TestCommand import nacl try: import nacl.nacl except ImportError: # installing - there is no cffi yet ext_modules = [] else: # building bdist - cffi is here! ext_modules = [nacl.nacl.ffi.verifier.get_extension()] class PyTest(TestCommand): def finalize_options(self): TestCommand.finalize_options(self) self.test_args = [] self.test_suite = True def run_tests(self): import pytest errno = pytest.main(self.test_args) sys.exit(errno) setup( name=nacl.__title__, version=nacl.__version__, description=nacl.__summary__, long_description=open("README.rst").read(), url=nacl.__uri__, license=nacl.__license__, author=nacl.__author__, author_email=nacl.__email__, install_requires=[ "cffi", ], extras_require={ "tests": ["pytest"], }, tests_require=["pytest"], packages=[ "nacl", "nacl.invoke", ], ext_package="nacl", ext_modules=ext_modules, zip_safe=False, cmdclass={"test": PyTest}, ) <commit_msg>Add clasifiers for the Python implementations and versions<commit_after>
#!/usr/bin/env python import sys from setuptools import setup from setuptools.command.test import test as TestCommand import nacl try: import nacl.nacl except ImportError: # installing - there is no cffi yet ext_modules = [] else: # building bdist - cffi is here! ext_modules = [nacl.nacl.ffi.verifier.get_extension()] class PyTest(TestCommand): def finalize_options(self): TestCommand.finalize_options(self) self.test_args = [] self.test_suite = True def run_tests(self): import pytest errno = pytest.main(self.test_args) sys.exit(errno) setup( name=nacl.__title__, version=nacl.__version__, description=nacl.__summary__, long_description=open("README.rst").read(), url=nacl.__uri__, license=nacl.__license__, author=nacl.__author__, author_email=nacl.__email__, install_requires=[ "cffi", ], extras_require={ "tests": ["pytest"], }, tests_require=["pytest"], packages=[ "nacl", "nacl.invoke", ], ext_package="nacl", ext_modules=ext_modules, zip_safe=False, cmdclass={"test": PyTest}, classifiers=[ "Programming Language :: Python :: Implementation :: CPython", "Programming Language :: Python :: Implementation :: PyPy", "Programming Language :: Python :: 2", "Programming Language :: Python :: 2.6", "Programming Language :: Python :: 2.7", "Programming Language :: Python :: 3", "Programming Language :: Python :: 3.2", "Programming Language :: Python :: 3.3", ] )
#!/usr/bin/env python import sys from setuptools import setup from setuptools.command.test import test as TestCommand import nacl try: import nacl.nacl except ImportError: # installing - there is no cffi yet ext_modules = [] else: # building bdist - cffi is here! ext_modules = [nacl.nacl.ffi.verifier.get_extension()] class PyTest(TestCommand): def finalize_options(self): TestCommand.finalize_options(self) self.test_args = [] self.test_suite = True def run_tests(self): import pytest errno = pytest.main(self.test_args) sys.exit(errno) setup( name=nacl.__title__, version=nacl.__version__, description=nacl.__summary__, long_description=open("README.rst").read(), url=nacl.__uri__, license=nacl.__license__, author=nacl.__author__, author_email=nacl.__email__, install_requires=[ "cffi", ], extras_require={ "tests": ["pytest"], }, tests_require=["pytest"], packages=[ "nacl", "nacl.invoke", ], ext_package="nacl", ext_modules=ext_modules, zip_safe=False, cmdclass={"test": PyTest}, ) Add clasifiers for the Python implementations and versions#!/usr/bin/env python import sys from setuptools import setup from setuptools.command.test import test as TestCommand import nacl try: import nacl.nacl except ImportError: # installing - there is no cffi yet ext_modules = [] else: # building bdist - cffi is here! ext_modules = [nacl.nacl.ffi.verifier.get_extension()] class PyTest(TestCommand): def finalize_options(self): TestCommand.finalize_options(self) self.test_args = [] self.test_suite = True def run_tests(self): import pytest errno = pytest.main(self.test_args) sys.exit(errno) setup( name=nacl.__title__, version=nacl.__version__, description=nacl.__summary__, long_description=open("README.rst").read(), url=nacl.__uri__, license=nacl.__license__, author=nacl.__author__, author_email=nacl.__email__, install_requires=[ "cffi", ], extras_require={ "tests": ["pytest"], }, tests_require=["pytest"], packages=[ "nacl", "nacl.invoke", ], ext_package="nacl", ext_modules=ext_modules, zip_safe=False, cmdclass={"test": PyTest}, classifiers=[ "Programming Language :: Python :: Implementation :: CPython", "Programming Language :: Python :: Implementation :: PyPy", "Programming Language :: Python :: 2", "Programming Language :: Python :: 2.6", "Programming Language :: Python :: 2.7", "Programming Language :: Python :: 3", "Programming Language :: Python :: 3.2", "Programming Language :: Python :: 3.3", ] )
<commit_before>#!/usr/bin/env python import sys from setuptools import setup from setuptools.command.test import test as TestCommand import nacl try: import nacl.nacl except ImportError: # installing - there is no cffi yet ext_modules = [] else: # building bdist - cffi is here! ext_modules = [nacl.nacl.ffi.verifier.get_extension()] class PyTest(TestCommand): def finalize_options(self): TestCommand.finalize_options(self) self.test_args = [] self.test_suite = True def run_tests(self): import pytest errno = pytest.main(self.test_args) sys.exit(errno) setup( name=nacl.__title__, version=nacl.__version__, description=nacl.__summary__, long_description=open("README.rst").read(), url=nacl.__uri__, license=nacl.__license__, author=nacl.__author__, author_email=nacl.__email__, install_requires=[ "cffi", ], extras_require={ "tests": ["pytest"], }, tests_require=["pytest"], packages=[ "nacl", "nacl.invoke", ], ext_package="nacl", ext_modules=ext_modules, zip_safe=False, cmdclass={"test": PyTest}, ) <commit_msg>Add clasifiers for the Python implementations and versions<commit_after>#!/usr/bin/env python import sys from setuptools import setup from setuptools.command.test import test as TestCommand import nacl try: import nacl.nacl except ImportError: # installing - there is no cffi yet ext_modules = [] else: # building bdist - cffi is here! ext_modules = [nacl.nacl.ffi.verifier.get_extension()] class PyTest(TestCommand): def finalize_options(self): TestCommand.finalize_options(self) self.test_args = [] self.test_suite = True def run_tests(self): import pytest errno = pytest.main(self.test_args) sys.exit(errno) setup( name=nacl.__title__, version=nacl.__version__, description=nacl.__summary__, long_description=open("README.rst").read(), url=nacl.__uri__, license=nacl.__license__, author=nacl.__author__, author_email=nacl.__email__, install_requires=[ "cffi", ], extras_require={ "tests": ["pytest"], }, tests_require=["pytest"], packages=[ "nacl", "nacl.invoke", ], ext_package="nacl", ext_modules=ext_modules, zip_safe=False, cmdclass={"test": PyTest}, classifiers=[ "Programming Language :: Python :: Implementation :: CPython", "Programming Language :: Python :: Implementation :: PyPy", "Programming Language :: Python :: 2", "Programming Language :: Python :: 2.6", "Programming Language :: Python :: 2.7", "Programming Language :: Python :: 3", "Programming Language :: Python :: 3.2", "Programming Language :: Python :: 3.3", ] )
a8c480cb079c32c4f589a795e12ba4854cb831cc
setup.py
setup.py
#!/usr/bin/env python # Copyright (C) 2013 SignalFuse, Inc. # Setuptools install description file. import os from setuptools import setup, find_packages setup( name='maestro', version='0.0.1', description='Orchestrator for multi-host Docker deployments', zip_safe=True, packages=find_packages(), install_requires=['docker-py'], dependency_links=['https://github.com/mpetazzoni/docker-py/archive/timeout-and-localbinddirs.zip#egg=docker-py'], classifiers=[ 'Development Status :: 3 - Alpha', 'Environment :: Console', 'Intended Audience :: Developers', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Utilities', ], entry_points={ 'console': ['maestro = maestro.maestro'], 'setuptools.installation': ['eggsecutable = maestro.maestro:main'], }, author='Maxime Petazzoni', author_email='[email protected]', license='GNU Lesser General Public License v3', keywords='maestro docker orchestration deployment', url='http://github.com/signalfuse/maestro-ng', )
#!/usr/bin/env python # Copyright (C) 2013 SignalFuse, Inc. # Setuptools install description file. import os from setuptools import setup, find_packages setup( name='maestro', version='0.0.1', description='Orchestrator for multi-host Docker deployments', zip_safe=True, packages=find_packages(), install_requires=['docker-py'], dependency_links=['https://github.com/mpetazzoni/docker-py/archive/next.zip#egg=docker-py'], classifiers=[ 'Development Status :: 3 - Alpha', 'Environment :: Console', 'Intended Audience :: Developers', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Utilities', ], entry_points={ 'console': ['maestro = maestro.maestro'], 'setuptools.installation': ['eggsecutable = maestro.maestro:main'], }, author='Maxime Petazzoni', author_email='[email protected]', license='GNU Lesser General Public License v3', keywords='maestro docker orchestration deployment', url='http://github.com/signalfuse/maestro-ng', )
Fix custom dependency on docker-py
Fix custom dependency on docker-py Signed-off-by: Maxime Petazzoni <[email protected]>
Python
apache-2.0
Anvil/maestro-ng,zsuzhengdu/maestro-ng,jorge-marques/maestro-ng,jorge-marques/maestro-ng,ivotron/maestro-ng,signalfuse/maestro-ng,zsuzhengdu/maestro-ng,signalfx/maestro-ng,Anvil/maestro-ng,signalfuse/maestro-ng,ivotron/maestro-ng,signalfx/maestro-ng
#!/usr/bin/env python # Copyright (C) 2013 SignalFuse, Inc. # Setuptools install description file. import os from setuptools import setup, find_packages setup( name='maestro', version='0.0.1', description='Orchestrator for multi-host Docker deployments', zip_safe=True, packages=find_packages(), install_requires=['docker-py'], dependency_links=['https://github.com/mpetazzoni/docker-py/archive/timeout-and-localbinddirs.zip#egg=docker-py'], classifiers=[ 'Development Status :: 3 - Alpha', 'Environment :: Console', 'Intended Audience :: Developers', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Utilities', ], entry_points={ 'console': ['maestro = maestro.maestro'], 'setuptools.installation': ['eggsecutable = maestro.maestro:main'], }, author='Maxime Petazzoni', author_email='[email protected]', license='GNU Lesser General Public License v3', keywords='maestro docker orchestration deployment', url='http://github.com/signalfuse/maestro-ng', ) Fix custom dependency on docker-py Signed-off-by: Maxime Petazzoni <[email protected]>
#!/usr/bin/env python # Copyright (C) 2013 SignalFuse, Inc. # Setuptools install description file. import os from setuptools import setup, find_packages setup( name='maestro', version='0.0.1', description='Orchestrator for multi-host Docker deployments', zip_safe=True, packages=find_packages(), install_requires=['docker-py'], dependency_links=['https://github.com/mpetazzoni/docker-py/archive/next.zip#egg=docker-py'], classifiers=[ 'Development Status :: 3 - Alpha', 'Environment :: Console', 'Intended Audience :: Developers', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Utilities', ], entry_points={ 'console': ['maestro = maestro.maestro'], 'setuptools.installation': ['eggsecutable = maestro.maestro:main'], }, author='Maxime Petazzoni', author_email='[email protected]', license='GNU Lesser General Public License v3', keywords='maestro docker orchestration deployment', url='http://github.com/signalfuse/maestro-ng', )
<commit_before>#!/usr/bin/env python # Copyright (C) 2013 SignalFuse, Inc. # Setuptools install description file. import os from setuptools import setup, find_packages setup( name='maestro', version='0.0.1', description='Orchestrator for multi-host Docker deployments', zip_safe=True, packages=find_packages(), install_requires=['docker-py'], dependency_links=['https://github.com/mpetazzoni/docker-py/archive/timeout-and-localbinddirs.zip#egg=docker-py'], classifiers=[ 'Development Status :: 3 - Alpha', 'Environment :: Console', 'Intended Audience :: Developers', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Utilities', ], entry_points={ 'console': ['maestro = maestro.maestro'], 'setuptools.installation': ['eggsecutable = maestro.maestro:main'], }, author='Maxime Petazzoni', author_email='[email protected]', license='GNU Lesser General Public License v3', keywords='maestro docker orchestration deployment', url='http://github.com/signalfuse/maestro-ng', ) <commit_msg>Fix custom dependency on docker-py Signed-off-by: Maxime Petazzoni <[email protected]><commit_after>
#!/usr/bin/env python # Copyright (C) 2013 SignalFuse, Inc. # Setuptools install description file. import os from setuptools import setup, find_packages setup( name='maestro', version='0.0.1', description='Orchestrator for multi-host Docker deployments', zip_safe=True, packages=find_packages(), install_requires=['docker-py'], dependency_links=['https://github.com/mpetazzoni/docker-py/archive/next.zip#egg=docker-py'], classifiers=[ 'Development Status :: 3 - Alpha', 'Environment :: Console', 'Intended Audience :: Developers', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Utilities', ], entry_points={ 'console': ['maestro = maestro.maestro'], 'setuptools.installation': ['eggsecutable = maestro.maestro:main'], }, author='Maxime Petazzoni', author_email='[email protected]', license='GNU Lesser General Public License v3', keywords='maestro docker orchestration deployment', url='http://github.com/signalfuse/maestro-ng', )
#!/usr/bin/env python # Copyright (C) 2013 SignalFuse, Inc. # Setuptools install description file. import os from setuptools import setup, find_packages setup( name='maestro', version='0.0.1', description='Orchestrator for multi-host Docker deployments', zip_safe=True, packages=find_packages(), install_requires=['docker-py'], dependency_links=['https://github.com/mpetazzoni/docker-py/archive/timeout-and-localbinddirs.zip#egg=docker-py'], classifiers=[ 'Development Status :: 3 - Alpha', 'Environment :: Console', 'Intended Audience :: Developers', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Utilities', ], entry_points={ 'console': ['maestro = maestro.maestro'], 'setuptools.installation': ['eggsecutable = maestro.maestro:main'], }, author='Maxime Petazzoni', author_email='[email protected]', license='GNU Lesser General Public License v3', keywords='maestro docker orchestration deployment', url='http://github.com/signalfuse/maestro-ng', ) Fix custom dependency on docker-py Signed-off-by: Maxime Petazzoni <[email protected]>#!/usr/bin/env python # Copyright (C) 2013 SignalFuse, Inc. # Setuptools install description file. import os from setuptools import setup, find_packages setup( name='maestro', version='0.0.1', description='Orchestrator for multi-host Docker deployments', zip_safe=True, packages=find_packages(), install_requires=['docker-py'], dependency_links=['https://github.com/mpetazzoni/docker-py/archive/next.zip#egg=docker-py'], classifiers=[ 'Development Status :: 3 - Alpha', 'Environment :: Console', 'Intended Audience :: Developers', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Utilities', ], entry_points={ 'console': ['maestro = maestro.maestro'], 'setuptools.installation': ['eggsecutable = maestro.maestro:main'], }, author='Maxime Petazzoni', author_email='[email protected]', license='GNU Lesser General Public License v3', keywords='maestro docker orchestration deployment', url='http://github.com/signalfuse/maestro-ng', )
<commit_before>#!/usr/bin/env python # Copyright (C) 2013 SignalFuse, Inc. # Setuptools install description file. import os from setuptools import setup, find_packages setup( name='maestro', version='0.0.1', description='Orchestrator for multi-host Docker deployments', zip_safe=True, packages=find_packages(), install_requires=['docker-py'], dependency_links=['https://github.com/mpetazzoni/docker-py/archive/timeout-and-localbinddirs.zip#egg=docker-py'], classifiers=[ 'Development Status :: 3 - Alpha', 'Environment :: Console', 'Intended Audience :: Developers', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Utilities', ], entry_points={ 'console': ['maestro = maestro.maestro'], 'setuptools.installation': ['eggsecutable = maestro.maestro:main'], }, author='Maxime Petazzoni', author_email='[email protected]', license='GNU Lesser General Public License v3', keywords='maestro docker orchestration deployment', url='http://github.com/signalfuse/maestro-ng', ) <commit_msg>Fix custom dependency on docker-py Signed-off-by: Maxime Petazzoni <[email protected]><commit_after>#!/usr/bin/env python # Copyright (C) 2013 SignalFuse, Inc. # Setuptools install description file. import os from setuptools import setup, find_packages setup( name='maestro', version='0.0.1', description='Orchestrator for multi-host Docker deployments', zip_safe=True, packages=find_packages(), install_requires=['docker-py'], dependency_links=['https://github.com/mpetazzoni/docker-py/archive/next.zip#egg=docker-py'], classifiers=[ 'Development Status :: 3 - Alpha', 'Environment :: Console', 'Intended Audience :: Developers', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Utilities', ], entry_points={ 'console': ['maestro = maestro.maestro'], 'setuptools.installation': ['eggsecutable = maestro.maestro:main'], }, author='Maxime Petazzoni', author_email='[email protected]', license='GNU Lesser General Public License v3', keywords='maestro docker orchestration deployment', url='http://github.com/signalfuse/maestro-ng', )
f1e48c8b50faf604e9fb42b0d4ac9524a8de6372
setup.py
setup.py
#!/usr/bin/env python try: from setuptools.core import setup except ImportError: from distutils.core import setup setup( name='django-iprestrict', version='0.2', description='Django app + middleware to restrict access to all or sections of a Django project by client IP ranges', long_description='Django app + middleware to restrict access to all or sections of a Django project by client IP ranges', author='Tamas Szabo', url='https://github.com/muccg/django-iprestrict', download_url='https://bitbucket.org/ccgmurdoch/ccg-django-extras/downloads/', classifiers=[ "Framework :: Django", "Intended Audience :: Developers", "Intended Audience :: System Administrators", "License :: OSI Approved :: MIT License", "Operating System :: OS Independent", "Topic :: Software Development" ], packages=[ 'iprestrict', 'iprestrict.management', 'iprestrict.management.commands', ], package_data={ 'iprestrict': [ 'templates/iprestrict/*', 'static/css/*', 'static/javascript/lib/*', 'fixtures/*', 'migrations/*', ] }, install_requires=[ 'South==0.7.6', 'django-templatetag-handlebars==1.2.0', ] )
#!/usr/bin/env python try: from setuptools.core import setup except ImportError: from distutils.core import setup setup( name='django-iprestrict', version='0.3', description='Django app + middleware to restrict access to all or sections of a Django project by client IP ranges', long_description='Django app + middleware to restrict access to all or sections of a Django project by client IP ranges', author='Tamas Szabo', url='https://github.com/muccg/django-iprestrict', download_url='https://bitbucket.org/ccgmurdoch/ccg-django-extras/downloads/', classifiers=[ "Framework :: Django", "Intended Audience :: Developers", "Intended Audience :: System Administrators", "License :: OSI Approved :: MIT License", "Operating System :: OS Independent", "Topic :: Software Development" ], packages=[ 'iprestrict', 'iprestrict.management', 'iprestrict.management.commands', ], package_data={ 'iprestrict': [ 'templates/iprestrict/*', 'static/css/*', 'static/javascript/lib/*', 'fixtures/*', 'migrations/*', ] }, install_requires=[ 'South==0.7.6', 'django-templatetag-handlebars==1.2.0', ] )
Bump version to 0.3, tag for 0.2 seems to exist already
Bump version to 0.3, tag for 0.2 seems to exist already
Python
bsd-3-clause
whyflyru/django-iprestrict,sociateru/django-iprestrict,sociateru/django-iprestrict,sociateru/django-iprestrict,whyflyru/django-iprestrict,sociateru/django-iprestrict,whyflyru/django-iprestrict,whyflyru/django-iprestrict,muccg/django-iprestrict,muccg/django-iprestrict,muccg/django-iprestrict
#!/usr/bin/env python try: from setuptools.core import setup except ImportError: from distutils.core import setup setup( name='django-iprestrict', version='0.2', description='Django app + middleware to restrict access to all or sections of a Django project by client IP ranges', long_description='Django app + middleware to restrict access to all or sections of a Django project by client IP ranges', author='Tamas Szabo', url='https://github.com/muccg/django-iprestrict', download_url='https://bitbucket.org/ccgmurdoch/ccg-django-extras/downloads/', classifiers=[ "Framework :: Django", "Intended Audience :: Developers", "Intended Audience :: System Administrators", "License :: OSI Approved :: MIT License", "Operating System :: OS Independent", "Topic :: Software Development" ], packages=[ 'iprestrict', 'iprestrict.management', 'iprestrict.management.commands', ], package_data={ 'iprestrict': [ 'templates/iprestrict/*', 'static/css/*', 'static/javascript/lib/*', 'fixtures/*', 'migrations/*', ] }, install_requires=[ 'South==0.7.6', 'django-templatetag-handlebars==1.2.0', ] ) Bump version to 0.3, tag for 0.2 seems to exist already
#!/usr/bin/env python try: from setuptools.core import setup except ImportError: from distutils.core import setup setup( name='django-iprestrict', version='0.3', description='Django app + middleware to restrict access to all or sections of a Django project by client IP ranges', long_description='Django app + middleware to restrict access to all or sections of a Django project by client IP ranges', author='Tamas Szabo', url='https://github.com/muccg/django-iprestrict', download_url='https://bitbucket.org/ccgmurdoch/ccg-django-extras/downloads/', classifiers=[ "Framework :: Django", "Intended Audience :: Developers", "Intended Audience :: System Administrators", "License :: OSI Approved :: MIT License", "Operating System :: OS Independent", "Topic :: Software Development" ], packages=[ 'iprestrict', 'iprestrict.management', 'iprestrict.management.commands', ], package_data={ 'iprestrict': [ 'templates/iprestrict/*', 'static/css/*', 'static/javascript/lib/*', 'fixtures/*', 'migrations/*', ] }, install_requires=[ 'South==0.7.6', 'django-templatetag-handlebars==1.2.0', ] )
<commit_before>#!/usr/bin/env python try: from setuptools.core import setup except ImportError: from distutils.core import setup setup( name='django-iprestrict', version='0.2', description='Django app + middleware to restrict access to all or sections of a Django project by client IP ranges', long_description='Django app + middleware to restrict access to all or sections of a Django project by client IP ranges', author='Tamas Szabo', url='https://github.com/muccg/django-iprestrict', download_url='https://bitbucket.org/ccgmurdoch/ccg-django-extras/downloads/', classifiers=[ "Framework :: Django", "Intended Audience :: Developers", "Intended Audience :: System Administrators", "License :: OSI Approved :: MIT License", "Operating System :: OS Independent", "Topic :: Software Development" ], packages=[ 'iprestrict', 'iprestrict.management', 'iprestrict.management.commands', ], package_data={ 'iprestrict': [ 'templates/iprestrict/*', 'static/css/*', 'static/javascript/lib/*', 'fixtures/*', 'migrations/*', ] }, install_requires=[ 'South==0.7.6', 'django-templatetag-handlebars==1.2.0', ] ) <commit_msg>Bump version to 0.3, tag for 0.2 seems to exist already<commit_after>
#!/usr/bin/env python try: from setuptools.core import setup except ImportError: from distutils.core import setup setup( name='django-iprestrict', version='0.3', description='Django app + middleware to restrict access to all or sections of a Django project by client IP ranges', long_description='Django app + middleware to restrict access to all or sections of a Django project by client IP ranges', author='Tamas Szabo', url='https://github.com/muccg/django-iprestrict', download_url='https://bitbucket.org/ccgmurdoch/ccg-django-extras/downloads/', classifiers=[ "Framework :: Django", "Intended Audience :: Developers", "Intended Audience :: System Administrators", "License :: OSI Approved :: MIT License", "Operating System :: OS Independent", "Topic :: Software Development" ], packages=[ 'iprestrict', 'iprestrict.management', 'iprestrict.management.commands', ], package_data={ 'iprestrict': [ 'templates/iprestrict/*', 'static/css/*', 'static/javascript/lib/*', 'fixtures/*', 'migrations/*', ] }, install_requires=[ 'South==0.7.6', 'django-templatetag-handlebars==1.2.0', ] )
#!/usr/bin/env python try: from setuptools.core import setup except ImportError: from distutils.core import setup setup( name='django-iprestrict', version='0.2', description='Django app + middleware to restrict access to all or sections of a Django project by client IP ranges', long_description='Django app + middleware to restrict access to all or sections of a Django project by client IP ranges', author='Tamas Szabo', url='https://github.com/muccg/django-iprestrict', download_url='https://bitbucket.org/ccgmurdoch/ccg-django-extras/downloads/', classifiers=[ "Framework :: Django", "Intended Audience :: Developers", "Intended Audience :: System Administrators", "License :: OSI Approved :: MIT License", "Operating System :: OS Independent", "Topic :: Software Development" ], packages=[ 'iprestrict', 'iprestrict.management', 'iprestrict.management.commands', ], package_data={ 'iprestrict': [ 'templates/iprestrict/*', 'static/css/*', 'static/javascript/lib/*', 'fixtures/*', 'migrations/*', ] }, install_requires=[ 'South==0.7.6', 'django-templatetag-handlebars==1.2.0', ] ) Bump version to 0.3, tag for 0.2 seems to exist already#!/usr/bin/env python try: from setuptools.core import setup except ImportError: from distutils.core import setup setup( name='django-iprestrict', version='0.3', description='Django app + middleware to restrict access to all or sections of a Django project by client IP ranges', long_description='Django app + middleware to restrict access to all or sections of a Django project by client IP ranges', author='Tamas Szabo', url='https://github.com/muccg/django-iprestrict', download_url='https://bitbucket.org/ccgmurdoch/ccg-django-extras/downloads/', classifiers=[ "Framework :: Django", "Intended Audience :: Developers", "Intended Audience :: System Administrators", "License :: OSI Approved :: MIT License", "Operating System :: OS Independent", "Topic :: Software Development" ], packages=[ 'iprestrict', 'iprestrict.management', 'iprestrict.management.commands', ], package_data={ 'iprestrict': [ 'templates/iprestrict/*', 'static/css/*', 'static/javascript/lib/*', 'fixtures/*', 'migrations/*', ] }, install_requires=[ 'South==0.7.6', 'django-templatetag-handlebars==1.2.0', ] )
<commit_before>#!/usr/bin/env python try: from setuptools.core import setup except ImportError: from distutils.core import setup setup( name='django-iprestrict', version='0.2', description='Django app + middleware to restrict access to all or sections of a Django project by client IP ranges', long_description='Django app + middleware to restrict access to all or sections of a Django project by client IP ranges', author='Tamas Szabo', url='https://github.com/muccg/django-iprestrict', download_url='https://bitbucket.org/ccgmurdoch/ccg-django-extras/downloads/', classifiers=[ "Framework :: Django", "Intended Audience :: Developers", "Intended Audience :: System Administrators", "License :: OSI Approved :: MIT License", "Operating System :: OS Independent", "Topic :: Software Development" ], packages=[ 'iprestrict', 'iprestrict.management', 'iprestrict.management.commands', ], package_data={ 'iprestrict': [ 'templates/iprestrict/*', 'static/css/*', 'static/javascript/lib/*', 'fixtures/*', 'migrations/*', ] }, install_requires=[ 'South==0.7.6', 'django-templatetag-handlebars==1.2.0', ] ) <commit_msg>Bump version to 0.3, tag for 0.2 seems to exist already<commit_after>#!/usr/bin/env python try: from setuptools.core import setup except ImportError: from distutils.core import setup setup( name='django-iprestrict', version='0.3', description='Django app + middleware to restrict access to all or sections of a Django project by client IP ranges', long_description='Django app + middleware to restrict access to all or sections of a Django project by client IP ranges', author='Tamas Szabo', url='https://github.com/muccg/django-iprestrict', download_url='https://bitbucket.org/ccgmurdoch/ccg-django-extras/downloads/', classifiers=[ "Framework :: Django", "Intended Audience :: Developers", "Intended Audience :: System Administrators", "License :: OSI Approved :: MIT License", "Operating System :: OS Independent", "Topic :: Software Development" ], packages=[ 'iprestrict', 'iprestrict.management', 'iprestrict.management.commands', ], package_data={ 'iprestrict': [ 'templates/iprestrict/*', 'static/css/*', 'static/javascript/lib/*', 'fixtures/*', 'migrations/*', ] }, install_requires=[ 'South==0.7.6', 'django-templatetag-handlebars==1.2.0', ] )
d7f0376c78859901ff567e2fcd65a3f3cd10e9d0
setup.py
setup.py
from setuptools import find_packages, setup setup(name="python-voc", version="0.0", description="A python utility for loading data in Pascal VOC format", author="Michele Pratusevich", author_email='[email protected]', platforms=["osx"], # or more specific, e.g. "win32", "cygwin", "osx" license="BSD", url="http://github.com/mprat/pascal-voc-python", packages=find_packages(), install_requires=[i.strip() for i in open("requirements.txt").readlines()] )
from setuptools import find_packages, setup setup(name="voc_utils", version="0.0", description="A python utility for loading data in Pascal VOC format", author="Michele Pratusevich", author_email='[email protected]', platforms=["osx"], # or more specific, e.g. "win32", "cygwin", "osx" license="BSD", url="http://github.com/mprat/pascal-voc-python", packages=find_packages(), install_requires=[i.strip() for i in open("requirements.txt").readlines()] )
Change package name to not have a dash
Change package name to not have a dash
Python
mit
mprat/pascal-voc-python
from setuptools import find_packages, setup setup(name="python-voc", version="0.0", description="A python utility for loading data in Pascal VOC format", author="Michele Pratusevich", author_email='[email protected]', platforms=["osx"], # or more specific, e.g. "win32", "cygwin", "osx" license="BSD", url="http://github.com/mprat/pascal-voc-python", packages=find_packages(), install_requires=[i.strip() for i in open("requirements.txt").readlines()] ) Change package name to not have a dash
from setuptools import find_packages, setup setup(name="voc_utils", version="0.0", description="A python utility for loading data in Pascal VOC format", author="Michele Pratusevich", author_email='[email protected]', platforms=["osx"], # or more specific, e.g. "win32", "cygwin", "osx" license="BSD", url="http://github.com/mprat/pascal-voc-python", packages=find_packages(), install_requires=[i.strip() for i in open("requirements.txt").readlines()] )
<commit_before>from setuptools import find_packages, setup setup(name="python-voc", version="0.0", description="A python utility for loading data in Pascal VOC format", author="Michele Pratusevich", author_email='[email protected]', platforms=["osx"], # or more specific, e.g. "win32", "cygwin", "osx" license="BSD", url="http://github.com/mprat/pascal-voc-python", packages=find_packages(), install_requires=[i.strip() for i in open("requirements.txt").readlines()] ) <commit_msg>Change package name to not have a dash<commit_after>
from setuptools import find_packages, setup setup(name="voc_utils", version="0.0", description="A python utility for loading data in Pascal VOC format", author="Michele Pratusevich", author_email='[email protected]', platforms=["osx"], # or more specific, e.g. "win32", "cygwin", "osx" license="BSD", url="http://github.com/mprat/pascal-voc-python", packages=find_packages(), install_requires=[i.strip() for i in open("requirements.txt").readlines()] )
from setuptools import find_packages, setup setup(name="python-voc", version="0.0", description="A python utility for loading data in Pascal VOC format", author="Michele Pratusevich", author_email='[email protected]', platforms=["osx"], # or more specific, e.g. "win32", "cygwin", "osx" license="BSD", url="http://github.com/mprat/pascal-voc-python", packages=find_packages(), install_requires=[i.strip() for i in open("requirements.txt").readlines()] ) Change package name to not have a dashfrom setuptools import find_packages, setup setup(name="voc_utils", version="0.0", description="A python utility for loading data in Pascal VOC format", author="Michele Pratusevich", author_email='[email protected]', platforms=["osx"], # or more specific, e.g. "win32", "cygwin", "osx" license="BSD", url="http://github.com/mprat/pascal-voc-python", packages=find_packages(), install_requires=[i.strip() for i in open("requirements.txt").readlines()] )
<commit_before>from setuptools import find_packages, setup setup(name="python-voc", version="0.0", description="A python utility for loading data in Pascal VOC format", author="Michele Pratusevich", author_email='[email protected]', platforms=["osx"], # or more specific, e.g. "win32", "cygwin", "osx" license="BSD", url="http://github.com/mprat/pascal-voc-python", packages=find_packages(), install_requires=[i.strip() for i in open("requirements.txt").readlines()] ) <commit_msg>Change package name to not have a dash<commit_after>from setuptools import find_packages, setup setup(name="voc_utils", version="0.0", description="A python utility for loading data in Pascal VOC format", author="Michele Pratusevich", author_email='[email protected]', platforms=["osx"], # or more specific, e.g. "win32", "cygwin", "osx" license="BSD", url="http://github.com/mprat/pascal-voc-python", packages=find_packages(), install_requires=[i.strip() for i in open("requirements.txt").readlines()] )
a4142dfea882c37ab1b1db14aa6e7740ed1f0103
setup.py
setup.py
#!/usr/bin/env python """Setup script for PythonTemplateDemo.""" import setuptools from demo import __project__, __version__ try: README = open("README.rst").read() CHANGELOG = open("CHANGELOG.rst").read() except IOError: LONG_DESCRIPTION = "<file not found>" else: LONG_DESCRIPTION = README + '\n' + CHANGELOG setuptools.setup( name=__project__, version=__version__, description="A sample project templated from jacebrowning/template-python.", url='https://github.com/jacebrowning/template-python-demo', author='Jace Browning', author_email='[email protected]', packages=setuptools.find_packages(), entry_points={'console_scripts': []}, long_description=LONG_DESCRIPTION, license='MIT', classifiers=[ # TODO: update this list to match your application: https://pypi.python.org/pypi?%3Aaction=list_classifiers 'Development Status :: 1 - Planning', 'Natural Language :: English', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', ], install_requires=open("requirements.txt").readlines(), )
#!/usr/bin/env python """Setup script for PythonTemplateDemo.""" import setuptools from demo import __project__, __version__ try: README = open("README.rst").read() CHANGELOG = open("CHANGELOG.rst").read() except IOError: LONG_DESCRIPTION = "<placeholder>" else: LONG_DESCRIPTION = README + '\n' + CHANGELOG setuptools.setup( name=__project__, version=__version__, description="A sample project templated from jacebrowning/template-python.", url='https://github.com/jacebrowning/template-python-demo', author='Jace Browning', author_email='[email protected]', packages=setuptools.find_packages(), entry_points={'console_scripts': []}, long_description=LONG_DESCRIPTION, license='MIT', classifiers=[ # TODO: update this list to match your application: https://pypi.python.org/pypi?%3Aaction=list_classifiers 'Development Status :: 1 - Planning', 'Natural Language :: English', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', ], install_requires=open("requirements.txt").readlines(), )
Deploy Travis CI build 720 to GitHub
Deploy Travis CI build 720 to GitHub
Python
mit
jacebrowning/template-python-demo
#!/usr/bin/env python """Setup script for PythonTemplateDemo.""" import setuptools from demo import __project__, __version__ try: README = open("README.rst").read() CHANGELOG = open("CHANGELOG.rst").read() except IOError: LONG_DESCRIPTION = "<file not found>" else: LONG_DESCRIPTION = README + '\n' + CHANGELOG setuptools.setup( name=__project__, version=__version__, description="A sample project templated from jacebrowning/template-python.", url='https://github.com/jacebrowning/template-python-demo', author='Jace Browning', author_email='[email protected]', packages=setuptools.find_packages(), entry_points={'console_scripts': []}, long_description=LONG_DESCRIPTION, license='MIT', classifiers=[ # TODO: update this list to match your application: https://pypi.python.org/pypi?%3Aaction=list_classifiers 'Development Status :: 1 - Planning', 'Natural Language :: English', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', ], install_requires=open("requirements.txt").readlines(), ) Deploy Travis CI build 720 to GitHub
#!/usr/bin/env python """Setup script for PythonTemplateDemo.""" import setuptools from demo import __project__, __version__ try: README = open("README.rst").read() CHANGELOG = open("CHANGELOG.rst").read() except IOError: LONG_DESCRIPTION = "<placeholder>" else: LONG_DESCRIPTION = README + '\n' + CHANGELOG setuptools.setup( name=__project__, version=__version__, description="A sample project templated from jacebrowning/template-python.", url='https://github.com/jacebrowning/template-python-demo', author='Jace Browning', author_email='[email protected]', packages=setuptools.find_packages(), entry_points={'console_scripts': []}, long_description=LONG_DESCRIPTION, license='MIT', classifiers=[ # TODO: update this list to match your application: https://pypi.python.org/pypi?%3Aaction=list_classifiers 'Development Status :: 1 - Planning', 'Natural Language :: English', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', ], install_requires=open("requirements.txt").readlines(), )
<commit_before>#!/usr/bin/env python """Setup script for PythonTemplateDemo.""" import setuptools from demo import __project__, __version__ try: README = open("README.rst").read() CHANGELOG = open("CHANGELOG.rst").read() except IOError: LONG_DESCRIPTION = "<file not found>" else: LONG_DESCRIPTION = README + '\n' + CHANGELOG setuptools.setup( name=__project__, version=__version__, description="A sample project templated from jacebrowning/template-python.", url='https://github.com/jacebrowning/template-python-demo', author='Jace Browning', author_email='[email protected]', packages=setuptools.find_packages(), entry_points={'console_scripts': []}, long_description=LONG_DESCRIPTION, license='MIT', classifiers=[ # TODO: update this list to match your application: https://pypi.python.org/pypi?%3Aaction=list_classifiers 'Development Status :: 1 - Planning', 'Natural Language :: English', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', ], install_requires=open("requirements.txt").readlines(), ) <commit_msg>Deploy Travis CI build 720 to GitHub<commit_after>
#!/usr/bin/env python """Setup script for PythonTemplateDemo.""" import setuptools from demo import __project__, __version__ try: README = open("README.rst").read() CHANGELOG = open("CHANGELOG.rst").read() except IOError: LONG_DESCRIPTION = "<placeholder>" else: LONG_DESCRIPTION = README + '\n' + CHANGELOG setuptools.setup( name=__project__, version=__version__, description="A sample project templated from jacebrowning/template-python.", url='https://github.com/jacebrowning/template-python-demo', author='Jace Browning', author_email='[email protected]', packages=setuptools.find_packages(), entry_points={'console_scripts': []}, long_description=LONG_DESCRIPTION, license='MIT', classifiers=[ # TODO: update this list to match your application: https://pypi.python.org/pypi?%3Aaction=list_classifiers 'Development Status :: 1 - Planning', 'Natural Language :: English', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', ], install_requires=open("requirements.txt").readlines(), )
#!/usr/bin/env python """Setup script for PythonTemplateDemo.""" import setuptools from demo import __project__, __version__ try: README = open("README.rst").read() CHANGELOG = open("CHANGELOG.rst").read() except IOError: LONG_DESCRIPTION = "<file not found>" else: LONG_DESCRIPTION = README + '\n' + CHANGELOG setuptools.setup( name=__project__, version=__version__, description="A sample project templated from jacebrowning/template-python.", url='https://github.com/jacebrowning/template-python-demo', author='Jace Browning', author_email='[email protected]', packages=setuptools.find_packages(), entry_points={'console_scripts': []}, long_description=LONG_DESCRIPTION, license='MIT', classifiers=[ # TODO: update this list to match your application: https://pypi.python.org/pypi?%3Aaction=list_classifiers 'Development Status :: 1 - Planning', 'Natural Language :: English', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', ], install_requires=open("requirements.txt").readlines(), ) Deploy Travis CI build 720 to GitHub#!/usr/bin/env python """Setup script for PythonTemplateDemo.""" import setuptools from demo import __project__, __version__ try: README = open("README.rst").read() CHANGELOG = open("CHANGELOG.rst").read() except IOError: LONG_DESCRIPTION = "<placeholder>" else: LONG_DESCRIPTION = README + '\n' + CHANGELOG setuptools.setup( name=__project__, version=__version__, description="A sample project templated from jacebrowning/template-python.", url='https://github.com/jacebrowning/template-python-demo', author='Jace Browning', author_email='[email protected]', packages=setuptools.find_packages(), entry_points={'console_scripts': []}, long_description=LONG_DESCRIPTION, license='MIT', classifiers=[ # TODO: update this list to match your application: https://pypi.python.org/pypi?%3Aaction=list_classifiers 'Development Status :: 1 - Planning', 'Natural Language :: English', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', ], install_requires=open("requirements.txt").readlines(), )
<commit_before>#!/usr/bin/env python """Setup script for PythonTemplateDemo.""" import setuptools from demo import __project__, __version__ try: README = open("README.rst").read() CHANGELOG = open("CHANGELOG.rst").read() except IOError: LONG_DESCRIPTION = "<file not found>" else: LONG_DESCRIPTION = README + '\n' + CHANGELOG setuptools.setup( name=__project__, version=__version__, description="A sample project templated from jacebrowning/template-python.", url='https://github.com/jacebrowning/template-python-demo', author='Jace Browning', author_email='[email protected]', packages=setuptools.find_packages(), entry_points={'console_scripts': []}, long_description=LONG_DESCRIPTION, license='MIT', classifiers=[ # TODO: update this list to match your application: https://pypi.python.org/pypi?%3Aaction=list_classifiers 'Development Status :: 1 - Planning', 'Natural Language :: English', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', ], install_requires=open("requirements.txt").readlines(), ) <commit_msg>Deploy Travis CI build 720 to GitHub<commit_after>#!/usr/bin/env python """Setup script for PythonTemplateDemo.""" import setuptools from demo import __project__, __version__ try: README = open("README.rst").read() CHANGELOG = open("CHANGELOG.rst").read() except IOError: LONG_DESCRIPTION = "<placeholder>" else: LONG_DESCRIPTION = README + '\n' + CHANGELOG setuptools.setup( name=__project__, version=__version__, description="A sample project templated from jacebrowning/template-python.", url='https://github.com/jacebrowning/template-python-demo', author='Jace Browning', author_email='[email protected]', packages=setuptools.find_packages(), entry_points={'console_scripts': []}, long_description=LONG_DESCRIPTION, license='MIT', classifiers=[ # TODO: update this list to match your application: https://pypi.python.org/pypi?%3Aaction=list_classifiers 'Development Status :: 1 - Planning', 'Natural Language :: English', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', ], install_requires=open("requirements.txt").readlines(), )
fa991297168f216c208d53b880124a4f23250034
setup.py
setup.py
import importlib from cx_Freeze import setup, Executable backend_path = importlib.import_module("bcrypt").__path__[0] backend_path = backend_path.replace("bcrypt", ".libs_cffi_backend") # Dependencies are automatically detected, but it might need # fine tuning. build_exe_options = { "include_files": [ ("client/dist", "client"), "LICENSE", "templates", "readme.md", (backend_path, "lib/.libs_cffi_backend") ], "includes": [ "cffi", "numpy", "numpy.core._methods", "numpy.lib", "numpy.lib.format", "raven.processors" ], "packages": [ "_cffi_backend", "appdirs", "asyncio", "bcrypt", "cffi", "idna", "motor", "packaging", "ssl", "uvloop" ] } options = { "build_exe": build_exe_options } executables = [ Executable('run.py', base="Console") ] classifiers=[ "Programming Language :: Python :: 3.7" ] importlib.import_module("virtool") setup(name='virtool', executables=executables, options=options, classifiers=classifiers, python_requires=">=3.6")
import importlib from cx_Freeze import setup, Executable backend_path = importlib.import_module("bcrypt").__path__[0] backend_path = backend_path.replace("bcrypt", ".libs_cffi_backend") # Dependencies are automatically detected, but it might need # fine tuning. build_exe_options = { "include_files": [ ("client/dist", "client"), "LICENSE", "templates", "readme.md", (backend_path, "lib/.libs_cffi_backend") ], "includes": [ "cffi", "numpy", "numpy.core._methods", "numpy.lib", "numpy.lib.format", "raven.processors" ], "packages": [ "_cffi_backend", "appdirs", "asyncio", "bcrypt", "cffi", "gzip", "idna", "motor", "packaging", "ssl", "uvloop" ] } options = { "build_exe": build_exe_options } executables = [ Executable('run.py', base="Console") ] classifiers=[ "Programming Language :: Python :: 3.7" ] importlib.import_module("virtool") setup(name='virtool', executables=executables, options=options, classifiers=classifiers, python_requires=">=3.6")
Add gzip to cx-freeze packages
Add gzip to cx-freeze packages
Python
mit
virtool/virtool,igboyes/virtool,virtool/virtool,igboyes/virtool
import importlib from cx_Freeze import setup, Executable backend_path = importlib.import_module("bcrypt").__path__[0] backend_path = backend_path.replace("bcrypt", ".libs_cffi_backend") # Dependencies are automatically detected, but it might need # fine tuning. build_exe_options = { "include_files": [ ("client/dist", "client"), "LICENSE", "templates", "readme.md", (backend_path, "lib/.libs_cffi_backend") ], "includes": [ "cffi", "numpy", "numpy.core._methods", "numpy.lib", "numpy.lib.format", "raven.processors" ], "packages": [ "_cffi_backend", "appdirs", "asyncio", "bcrypt", "cffi", "idna", "motor", "packaging", "ssl", "uvloop" ] } options = { "build_exe": build_exe_options } executables = [ Executable('run.py', base="Console") ] classifiers=[ "Programming Language :: Python :: 3.7" ] importlib.import_module("virtool") setup(name='virtool', executables=executables, options=options, classifiers=classifiers, python_requires=">=3.6") Add gzip to cx-freeze packages
import importlib from cx_Freeze import setup, Executable backend_path = importlib.import_module("bcrypt").__path__[0] backend_path = backend_path.replace("bcrypt", ".libs_cffi_backend") # Dependencies are automatically detected, but it might need # fine tuning. build_exe_options = { "include_files": [ ("client/dist", "client"), "LICENSE", "templates", "readme.md", (backend_path, "lib/.libs_cffi_backend") ], "includes": [ "cffi", "numpy", "numpy.core._methods", "numpy.lib", "numpy.lib.format", "raven.processors" ], "packages": [ "_cffi_backend", "appdirs", "asyncio", "bcrypt", "cffi", "gzip", "idna", "motor", "packaging", "ssl", "uvloop" ] } options = { "build_exe": build_exe_options } executables = [ Executable('run.py', base="Console") ] classifiers=[ "Programming Language :: Python :: 3.7" ] importlib.import_module("virtool") setup(name='virtool', executables=executables, options=options, classifiers=classifiers, python_requires=">=3.6")
<commit_before>import importlib from cx_Freeze import setup, Executable backend_path = importlib.import_module("bcrypt").__path__[0] backend_path = backend_path.replace("bcrypt", ".libs_cffi_backend") # Dependencies are automatically detected, but it might need # fine tuning. build_exe_options = { "include_files": [ ("client/dist", "client"), "LICENSE", "templates", "readme.md", (backend_path, "lib/.libs_cffi_backend") ], "includes": [ "cffi", "numpy", "numpy.core._methods", "numpy.lib", "numpy.lib.format", "raven.processors" ], "packages": [ "_cffi_backend", "appdirs", "asyncio", "bcrypt", "cffi", "idna", "motor", "packaging", "ssl", "uvloop" ] } options = { "build_exe": build_exe_options } executables = [ Executable('run.py', base="Console") ] classifiers=[ "Programming Language :: Python :: 3.7" ] importlib.import_module("virtool") setup(name='virtool', executables=executables, options=options, classifiers=classifiers, python_requires=">=3.6") <commit_msg>Add gzip to cx-freeze packages<commit_after>
import importlib from cx_Freeze import setup, Executable backend_path = importlib.import_module("bcrypt").__path__[0] backend_path = backend_path.replace("bcrypt", ".libs_cffi_backend") # Dependencies are automatically detected, but it might need # fine tuning. build_exe_options = { "include_files": [ ("client/dist", "client"), "LICENSE", "templates", "readme.md", (backend_path, "lib/.libs_cffi_backend") ], "includes": [ "cffi", "numpy", "numpy.core._methods", "numpy.lib", "numpy.lib.format", "raven.processors" ], "packages": [ "_cffi_backend", "appdirs", "asyncio", "bcrypt", "cffi", "gzip", "idna", "motor", "packaging", "ssl", "uvloop" ] } options = { "build_exe": build_exe_options } executables = [ Executable('run.py', base="Console") ] classifiers=[ "Programming Language :: Python :: 3.7" ] importlib.import_module("virtool") setup(name='virtool', executables=executables, options=options, classifiers=classifiers, python_requires=">=3.6")
import importlib from cx_Freeze import setup, Executable backend_path = importlib.import_module("bcrypt").__path__[0] backend_path = backend_path.replace("bcrypt", ".libs_cffi_backend") # Dependencies are automatically detected, but it might need # fine tuning. build_exe_options = { "include_files": [ ("client/dist", "client"), "LICENSE", "templates", "readme.md", (backend_path, "lib/.libs_cffi_backend") ], "includes": [ "cffi", "numpy", "numpy.core._methods", "numpy.lib", "numpy.lib.format", "raven.processors" ], "packages": [ "_cffi_backend", "appdirs", "asyncio", "bcrypt", "cffi", "idna", "motor", "packaging", "ssl", "uvloop" ] } options = { "build_exe": build_exe_options } executables = [ Executable('run.py', base="Console") ] classifiers=[ "Programming Language :: Python :: 3.7" ] importlib.import_module("virtool") setup(name='virtool', executables=executables, options=options, classifiers=classifiers, python_requires=">=3.6") Add gzip to cx-freeze packagesimport importlib from cx_Freeze import setup, Executable backend_path = importlib.import_module("bcrypt").__path__[0] backend_path = backend_path.replace("bcrypt", ".libs_cffi_backend") # Dependencies are automatically detected, but it might need # fine tuning. build_exe_options = { "include_files": [ ("client/dist", "client"), "LICENSE", "templates", "readme.md", (backend_path, "lib/.libs_cffi_backend") ], "includes": [ "cffi", "numpy", "numpy.core._methods", "numpy.lib", "numpy.lib.format", "raven.processors" ], "packages": [ "_cffi_backend", "appdirs", "asyncio", "bcrypt", "cffi", "gzip", "idna", "motor", "packaging", "ssl", "uvloop" ] } options = { "build_exe": build_exe_options } executables = [ Executable('run.py', base="Console") ] classifiers=[ "Programming Language :: Python :: 3.7" ] importlib.import_module("virtool") setup(name='virtool', executables=executables, options=options, classifiers=classifiers, python_requires=">=3.6")
<commit_before>import importlib from cx_Freeze import setup, Executable backend_path = importlib.import_module("bcrypt").__path__[0] backend_path = backend_path.replace("bcrypt", ".libs_cffi_backend") # Dependencies are automatically detected, but it might need # fine tuning. build_exe_options = { "include_files": [ ("client/dist", "client"), "LICENSE", "templates", "readme.md", (backend_path, "lib/.libs_cffi_backend") ], "includes": [ "cffi", "numpy", "numpy.core._methods", "numpy.lib", "numpy.lib.format", "raven.processors" ], "packages": [ "_cffi_backend", "appdirs", "asyncio", "bcrypt", "cffi", "idna", "motor", "packaging", "ssl", "uvloop" ] } options = { "build_exe": build_exe_options } executables = [ Executable('run.py', base="Console") ] classifiers=[ "Programming Language :: Python :: 3.7" ] importlib.import_module("virtool") setup(name='virtool', executables=executables, options=options, classifiers=classifiers, python_requires=">=3.6") <commit_msg>Add gzip to cx-freeze packages<commit_after>import importlib from cx_Freeze import setup, Executable backend_path = importlib.import_module("bcrypt").__path__[0] backend_path = backend_path.replace("bcrypt", ".libs_cffi_backend") # Dependencies are automatically detected, but it might need # fine tuning. build_exe_options = { "include_files": [ ("client/dist", "client"), "LICENSE", "templates", "readme.md", (backend_path, "lib/.libs_cffi_backend") ], "includes": [ "cffi", "numpy", "numpy.core._methods", "numpy.lib", "numpy.lib.format", "raven.processors" ], "packages": [ "_cffi_backend", "appdirs", "asyncio", "bcrypt", "cffi", "gzip", "idna", "motor", "packaging", "ssl", "uvloop" ] } options = { "build_exe": build_exe_options } executables = [ Executable('run.py', base="Console") ] classifiers=[ "Programming Language :: Python :: 3.7" ] importlib.import_module("virtool") setup(name='virtool', executables=executables, options=options, classifiers=classifiers, python_requires=">=3.6")
a735cf90640899bc83a57f7b079b100f61f56e41
setup.py
setup.py
from distutils.core import setup from os.path import exists setup( name = "fsmonitor", version = "0.1", description = "Filesystem monitoring", long_description=(open('README.rst').read() if exists('README.rst') else ''), author = "Luke McCarthy", author_email = "[email protected]", licence="MIT", url = "http://github.com/shaurz/fsmonitor", install_requires=[ 'pypiwin32', ], packages = ["fsmonitor"], )
from distutils.core import setup from os.path import exists from platform import system requires = [] if system == "Windows": requires = ["pypiwin32"] setup( name = "fsmonitor", version = "0.1", description = "Filesystem monitoring", long_description=(open('README.rst').read() if exists('README.rst') else ''), author = "Luke McCarthy", author_email = "[email protected]", licence="MIT", url = "http://github.com/shaurz/fsmonitor", install_requires=requires, packages = ["fsmonitor"], )
Add requires pywin32 only for Windows
Add requires pywin32 only for Windows
Python
mit
shaurz/fsmonitor
from distutils.core import setup from os.path import exists setup( name = "fsmonitor", version = "0.1", description = "Filesystem monitoring", long_description=(open('README.rst').read() if exists('README.rst') else ''), author = "Luke McCarthy", author_email = "[email protected]", licence="MIT", url = "http://github.com/shaurz/fsmonitor", install_requires=[ 'pypiwin32', ], packages = ["fsmonitor"], ) Add requires pywin32 only for Windows
from distutils.core import setup from os.path import exists from platform import system requires = [] if system == "Windows": requires = ["pypiwin32"] setup( name = "fsmonitor", version = "0.1", description = "Filesystem monitoring", long_description=(open('README.rst').read() if exists('README.rst') else ''), author = "Luke McCarthy", author_email = "[email protected]", licence="MIT", url = "http://github.com/shaurz/fsmonitor", install_requires=requires, packages = ["fsmonitor"], )
<commit_before>from distutils.core import setup from os.path import exists setup( name = "fsmonitor", version = "0.1", description = "Filesystem monitoring", long_description=(open('README.rst').read() if exists('README.rst') else ''), author = "Luke McCarthy", author_email = "[email protected]", licence="MIT", url = "http://github.com/shaurz/fsmonitor", install_requires=[ 'pypiwin32', ], packages = ["fsmonitor"], ) <commit_msg>Add requires pywin32 only for Windows<commit_after>
from distutils.core import setup from os.path import exists from platform import system requires = [] if system == "Windows": requires = ["pypiwin32"] setup( name = "fsmonitor", version = "0.1", description = "Filesystem monitoring", long_description=(open('README.rst').read() if exists('README.rst') else ''), author = "Luke McCarthy", author_email = "[email protected]", licence="MIT", url = "http://github.com/shaurz/fsmonitor", install_requires=requires, packages = ["fsmonitor"], )
from distutils.core import setup from os.path import exists setup( name = "fsmonitor", version = "0.1", description = "Filesystem monitoring", long_description=(open('README.rst').read() if exists('README.rst') else ''), author = "Luke McCarthy", author_email = "[email protected]", licence="MIT", url = "http://github.com/shaurz/fsmonitor", install_requires=[ 'pypiwin32', ], packages = ["fsmonitor"], ) Add requires pywin32 only for Windowsfrom distutils.core import setup from os.path import exists from platform import system requires = [] if system == "Windows": requires = ["pypiwin32"] setup( name = "fsmonitor", version = "0.1", description = "Filesystem monitoring", long_description=(open('README.rst').read() if exists('README.rst') else ''), author = "Luke McCarthy", author_email = "[email protected]", licence="MIT", url = "http://github.com/shaurz/fsmonitor", install_requires=requires, packages = ["fsmonitor"], )
<commit_before>from distutils.core import setup from os.path import exists setup( name = "fsmonitor", version = "0.1", description = "Filesystem monitoring", long_description=(open('README.rst').read() if exists('README.rst') else ''), author = "Luke McCarthy", author_email = "[email protected]", licence="MIT", url = "http://github.com/shaurz/fsmonitor", install_requires=[ 'pypiwin32', ], packages = ["fsmonitor"], ) <commit_msg>Add requires pywin32 only for Windows<commit_after>from distutils.core import setup from os.path import exists from platform import system requires = [] if system == "Windows": requires = ["pypiwin32"] setup( name = "fsmonitor", version = "0.1", description = "Filesystem monitoring", long_description=(open('README.rst').read() if exists('README.rst') else ''), author = "Luke McCarthy", author_email = "[email protected]", licence="MIT", url = "http://github.com/shaurz/fsmonitor", install_requires=requires, packages = ["fsmonitor"], )
ec06de04a6696894e3058ca00e53c13ad441b357
setup.py
setup.py
from distutils.core import setup setup( name="simple_slack_bot", packages=["simple_slack_bot"], # this must be the same as the name above version="1.3.0", description="Simple Slack Bot makes writing your next Slack bot incredibly easy", long_description="Simple Slack Bot makes writing your next Slack bot incredibly easy. By factoring out common functionality all Slack Bots require, you can focus on writing your business logic by simply registering for Slack Events defined by the Slack API", author="Greg Hilston", author_email="[email protected]", url="https://github.com/GregHilston/Simple-Slack-Bot", # use the URL to the github repo download_url="https://github.com/GregHilston/Simple-Slack-Bot/tarball/v1.1.0", keywords=["slack", "bot", "chat", "simple"], # arbitrary keywords classifiers=[], install_requires=[ "slacker==0.9", "slacksocket>=0.7,!=0.8,<=0.9", "pyyaml", "websocket-client==0.48", # required to define as our dependency has a dependency which broke backwards compatibility ], )
from distutils.core import setup setup( name="simple_slack_bot", packages=["simple_slack_bot"], # this must be the same as the name above version="1.3.1", description="Simple Slack Bot makes writing your next Slack bot incredibly easy", long_description="Simple Slack Bot makes writing your next Slack bot incredibly easy. By factoring out common functionality all Slack Bots require, you can focus on writing your business logic by simply registering for Slack Events defined by the Slack API", author="Greg Hilston", author_email="[email protected]", url="https://github.com/GregHilston/Simple-Slack-Bot", # use the URL to the github repo download_url="https://github.com/GregHilston/Simple-Slack-Bot/tarball/v1.1.0", keywords=["slack", "bot", "chat", "simple"], # arbitrary keywords classifiers=[], install_requires=[ "slacker==0.9", "slacksocket>=0.7,!=0.8,<=0.9", "pyyaml", "websocket-client==0.48", # required to define as our dependency has a dependency which broke backwards compatibility ], )
Increment that pip package version to 1.3.1
Increment that pip package version to 1.3.1 I incremented the last value as I am suggesting that not requiring certain pip dependencies put the project into a bad state... Some may consider that a bug. Either way :)
Python
mit
GregHilston/Simple-Slack-Bot
from distutils.core import setup setup( name="simple_slack_bot", packages=["simple_slack_bot"], # this must be the same as the name above version="1.3.0", description="Simple Slack Bot makes writing your next Slack bot incredibly easy", long_description="Simple Slack Bot makes writing your next Slack bot incredibly easy. By factoring out common functionality all Slack Bots require, you can focus on writing your business logic by simply registering for Slack Events defined by the Slack API", author="Greg Hilston", author_email="[email protected]", url="https://github.com/GregHilston/Simple-Slack-Bot", # use the URL to the github repo download_url="https://github.com/GregHilston/Simple-Slack-Bot/tarball/v1.1.0", keywords=["slack", "bot", "chat", "simple"], # arbitrary keywords classifiers=[], install_requires=[ "slacker==0.9", "slacksocket>=0.7,!=0.8,<=0.9", "pyyaml", "websocket-client==0.48", # required to define as our dependency has a dependency which broke backwards compatibility ], ) Increment that pip package version to 1.3.1 I incremented the last value as I am suggesting that not requiring certain pip dependencies put the project into a bad state... Some may consider that a bug. Either way :)
from distutils.core import setup setup( name="simple_slack_bot", packages=["simple_slack_bot"], # this must be the same as the name above version="1.3.1", description="Simple Slack Bot makes writing your next Slack bot incredibly easy", long_description="Simple Slack Bot makes writing your next Slack bot incredibly easy. By factoring out common functionality all Slack Bots require, you can focus on writing your business logic by simply registering for Slack Events defined by the Slack API", author="Greg Hilston", author_email="[email protected]", url="https://github.com/GregHilston/Simple-Slack-Bot", # use the URL to the github repo download_url="https://github.com/GregHilston/Simple-Slack-Bot/tarball/v1.1.0", keywords=["slack", "bot", "chat", "simple"], # arbitrary keywords classifiers=[], install_requires=[ "slacker==0.9", "slacksocket>=0.7,!=0.8,<=0.9", "pyyaml", "websocket-client==0.48", # required to define as our dependency has a dependency which broke backwards compatibility ], )
<commit_before>from distutils.core import setup setup( name="simple_slack_bot", packages=["simple_slack_bot"], # this must be the same as the name above version="1.3.0", description="Simple Slack Bot makes writing your next Slack bot incredibly easy", long_description="Simple Slack Bot makes writing your next Slack bot incredibly easy. By factoring out common functionality all Slack Bots require, you can focus on writing your business logic by simply registering for Slack Events defined by the Slack API", author="Greg Hilston", author_email="[email protected]", url="https://github.com/GregHilston/Simple-Slack-Bot", # use the URL to the github repo download_url="https://github.com/GregHilston/Simple-Slack-Bot/tarball/v1.1.0", keywords=["slack", "bot", "chat", "simple"], # arbitrary keywords classifiers=[], install_requires=[ "slacker==0.9", "slacksocket>=0.7,!=0.8,<=0.9", "pyyaml", "websocket-client==0.48", # required to define as our dependency has a dependency which broke backwards compatibility ], ) <commit_msg>Increment that pip package version to 1.3.1 I incremented the last value as I am suggesting that not requiring certain pip dependencies put the project into a bad state... Some may consider that a bug. Either way :)<commit_after>
from distutils.core import setup setup( name="simple_slack_bot", packages=["simple_slack_bot"], # this must be the same as the name above version="1.3.1", description="Simple Slack Bot makes writing your next Slack bot incredibly easy", long_description="Simple Slack Bot makes writing your next Slack bot incredibly easy. By factoring out common functionality all Slack Bots require, you can focus on writing your business logic by simply registering for Slack Events defined by the Slack API", author="Greg Hilston", author_email="[email protected]", url="https://github.com/GregHilston/Simple-Slack-Bot", # use the URL to the github repo download_url="https://github.com/GregHilston/Simple-Slack-Bot/tarball/v1.1.0", keywords=["slack", "bot", "chat", "simple"], # arbitrary keywords classifiers=[], install_requires=[ "slacker==0.9", "slacksocket>=0.7,!=0.8,<=0.9", "pyyaml", "websocket-client==0.48", # required to define as our dependency has a dependency which broke backwards compatibility ], )
from distutils.core import setup setup( name="simple_slack_bot", packages=["simple_slack_bot"], # this must be the same as the name above version="1.3.0", description="Simple Slack Bot makes writing your next Slack bot incredibly easy", long_description="Simple Slack Bot makes writing your next Slack bot incredibly easy. By factoring out common functionality all Slack Bots require, you can focus on writing your business logic by simply registering for Slack Events defined by the Slack API", author="Greg Hilston", author_email="[email protected]", url="https://github.com/GregHilston/Simple-Slack-Bot", # use the URL to the github repo download_url="https://github.com/GregHilston/Simple-Slack-Bot/tarball/v1.1.0", keywords=["slack", "bot", "chat", "simple"], # arbitrary keywords classifiers=[], install_requires=[ "slacker==0.9", "slacksocket>=0.7,!=0.8,<=0.9", "pyyaml", "websocket-client==0.48", # required to define as our dependency has a dependency which broke backwards compatibility ], ) Increment that pip package version to 1.3.1 I incremented the last value as I am suggesting that not requiring certain pip dependencies put the project into a bad state... Some may consider that a bug. Either way :)from distutils.core import setup setup( name="simple_slack_bot", packages=["simple_slack_bot"], # this must be the same as the name above version="1.3.1", description="Simple Slack Bot makes writing your next Slack bot incredibly easy", long_description="Simple Slack Bot makes writing your next Slack bot incredibly easy. By factoring out common functionality all Slack Bots require, you can focus on writing your business logic by simply registering for Slack Events defined by the Slack API", author="Greg Hilston", author_email="[email protected]", url="https://github.com/GregHilston/Simple-Slack-Bot", # use the URL to the github repo download_url="https://github.com/GregHilston/Simple-Slack-Bot/tarball/v1.1.0", keywords=["slack", "bot", "chat", "simple"], # arbitrary keywords classifiers=[], install_requires=[ "slacker==0.9", "slacksocket>=0.7,!=0.8,<=0.9", "pyyaml", "websocket-client==0.48", # required to define as our dependency has a dependency which broke backwards compatibility ], )
<commit_before>from distutils.core import setup setup( name="simple_slack_bot", packages=["simple_slack_bot"], # this must be the same as the name above version="1.3.0", description="Simple Slack Bot makes writing your next Slack bot incredibly easy", long_description="Simple Slack Bot makes writing your next Slack bot incredibly easy. By factoring out common functionality all Slack Bots require, you can focus on writing your business logic by simply registering for Slack Events defined by the Slack API", author="Greg Hilston", author_email="[email protected]", url="https://github.com/GregHilston/Simple-Slack-Bot", # use the URL to the github repo download_url="https://github.com/GregHilston/Simple-Slack-Bot/tarball/v1.1.0", keywords=["slack", "bot", "chat", "simple"], # arbitrary keywords classifiers=[], install_requires=[ "slacker==0.9", "slacksocket>=0.7,!=0.8,<=0.9", "pyyaml", "websocket-client==0.48", # required to define as our dependency has a dependency which broke backwards compatibility ], ) <commit_msg>Increment that pip package version to 1.3.1 I incremented the last value as I am suggesting that not requiring certain pip dependencies put the project into a bad state... Some may consider that a bug. Either way :)<commit_after>from distutils.core import setup setup( name="simple_slack_bot", packages=["simple_slack_bot"], # this must be the same as the name above version="1.3.1", description="Simple Slack Bot makes writing your next Slack bot incredibly easy", long_description="Simple Slack Bot makes writing your next Slack bot incredibly easy. By factoring out common functionality all Slack Bots require, you can focus on writing your business logic by simply registering for Slack Events defined by the Slack API", author="Greg Hilston", author_email="[email protected]", url="https://github.com/GregHilston/Simple-Slack-Bot", # use the URL to the github repo download_url="https://github.com/GregHilston/Simple-Slack-Bot/tarball/v1.1.0", keywords=["slack", "bot", "chat", "simple"], # arbitrary keywords classifiers=[], install_requires=[ "slacker==0.9", "slacksocket>=0.7,!=0.8,<=0.9", "pyyaml", "websocket-client==0.48", # required to define as our dependency has a dependency which broke backwards compatibility ], )
ffe553cf7651ab23fd5faa6c9f8525004a9b8fda
setup.py
setup.py
import os from setuptools import setup README = open(os.path.join(os.path.dirname(__file__), 'README.md')).read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='django-swiftbrowser', version='0.21', packages=['swiftbrowser'], include_package_data=True, license='Apache License (2.0)', description='A simple Django app to access Openstack Swift', long_description=README, url='https://github.com/cschwede/django-swiftbrowser', author='Christian Schwede', author_email='[email protected]', install_requires=['django>=1.5', 'python-swiftclient'], zip_safe=False, classifiers=[ 'Environment :: Web Environment', 'Framework :: Django', 'Intended Audience :: Developers', 'License :: OSI Approved :: Apache Software License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2.6', 'Programming Language :: Python :: 2.7', 'Topic :: Internet :: WWW/HTTP', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', ], )
import os from setuptools import setup README = open(os.path.join(os.path.dirname(__file__), 'README.md')).read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='django-swiftbrowser', version='0.22', packages=['swiftbrowser'], include_package_data=True, license='Apache License (2.0)', description='A simple Django app to access Openstack Swift', long_description=README, url='https://github.com/cschwede/django-swiftbrowser', author='Christian Schwede', author_email='[email protected]', install_requires=['django>=1.5', 'python-swiftclient'], zip_safe=False, classifiers=[ 'Environment :: Web Environment', 'Framework :: Django', 'Intended Audience :: Developers', 'License :: OSI Approved :: Apache Software License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2.6', 'Programming Language :: Python :: 2.7', 'Topic :: Internet :: WWW/HTTP', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', ], )
Fix bug when creating temporary URLs
Fix bug when creating temporary URLs Pythons HMAC does not accept unicode, therefore converting key and hmac body to string (to be compatible with Python 2.x). Python 3 needs a byte conversion. See also: http://bugs.python.org/issue5285
Python
apache-2.0
honza801/django-swiftbrowser,cschwede/django-swiftbrowser,honza801/django-swiftbrowser,cschwede/django-swiftbrowser,honza801/django-swiftbrowser
import os from setuptools import setup README = open(os.path.join(os.path.dirname(__file__), 'README.md')).read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='django-swiftbrowser', version='0.21', packages=['swiftbrowser'], include_package_data=True, license='Apache License (2.0)', description='A simple Django app to access Openstack Swift', long_description=README, url='https://github.com/cschwede/django-swiftbrowser', author='Christian Schwede', author_email='[email protected]', install_requires=['django>=1.5', 'python-swiftclient'], zip_safe=False, classifiers=[ 'Environment :: Web Environment', 'Framework :: Django', 'Intended Audience :: Developers', 'License :: OSI Approved :: Apache Software License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2.6', 'Programming Language :: Python :: 2.7', 'Topic :: Internet :: WWW/HTTP', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', ], ) Fix bug when creating temporary URLs Pythons HMAC does not accept unicode, therefore converting key and hmac body to string (to be compatible with Python 2.x). Python 3 needs a byte conversion. See also: http://bugs.python.org/issue5285
import os from setuptools import setup README = open(os.path.join(os.path.dirname(__file__), 'README.md')).read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='django-swiftbrowser', version='0.22', packages=['swiftbrowser'], include_package_data=True, license='Apache License (2.0)', description='A simple Django app to access Openstack Swift', long_description=README, url='https://github.com/cschwede/django-swiftbrowser', author='Christian Schwede', author_email='[email protected]', install_requires=['django>=1.5', 'python-swiftclient'], zip_safe=False, classifiers=[ 'Environment :: Web Environment', 'Framework :: Django', 'Intended Audience :: Developers', 'License :: OSI Approved :: Apache Software License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2.6', 'Programming Language :: Python :: 2.7', 'Topic :: Internet :: WWW/HTTP', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', ], )
<commit_before>import os from setuptools import setup README = open(os.path.join(os.path.dirname(__file__), 'README.md')).read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='django-swiftbrowser', version='0.21', packages=['swiftbrowser'], include_package_data=True, license='Apache License (2.0)', description='A simple Django app to access Openstack Swift', long_description=README, url='https://github.com/cschwede/django-swiftbrowser', author='Christian Schwede', author_email='[email protected]', install_requires=['django>=1.5', 'python-swiftclient'], zip_safe=False, classifiers=[ 'Environment :: Web Environment', 'Framework :: Django', 'Intended Audience :: Developers', 'License :: OSI Approved :: Apache Software License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2.6', 'Programming Language :: Python :: 2.7', 'Topic :: Internet :: WWW/HTTP', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', ], ) <commit_msg>Fix bug when creating temporary URLs Pythons HMAC does not accept unicode, therefore converting key and hmac body to string (to be compatible with Python 2.x). Python 3 needs a byte conversion. See also: http://bugs.python.org/issue5285<commit_after>
import os from setuptools import setup README = open(os.path.join(os.path.dirname(__file__), 'README.md')).read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='django-swiftbrowser', version='0.22', packages=['swiftbrowser'], include_package_data=True, license='Apache License (2.0)', description='A simple Django app to access Openstack Swift', long_description=README, url='https://github.com/cschwede/django-swiftbrowser', author='Christian Schwede', author_email='[email protected]', install_requires=['django>=1.5', 'python-swiftclient'], zip_safe=False, classifiers=[ 'Environment :: Web Environment', 'Framework :: Django', 'Intended Audience :: Developers', 'License :: OSI Approved :: Apache Software License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2.6', 'Programming Language :: Python :: 2.7', 'Topic :: Internet :: WWW/HTTP', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', ], )
import os from setuptools import setup README = open(os.path.join(os.path.dirname(__file__), 'README.md')).read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='django-swiftbrowser', version='0.21', packages=['swiftbrowser'], include_package_data=True, license='Apache License (2.0)', description='A simple Django app to access Openstack Swift', long_description=README, url='https://github.com/cschwede/django-swiftbrowser', author='Christian Schwede', author_email='[email protected]', install_requires=['django>=1.5', 'python-swiftclient'], zip_safe=False, classifiers=[ 'Environment :: Web Environment', 'Framework :: Django', 'Intended Audience :: Developers', 'License :: OSI Approved :: Apache Software License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2.6', 'Programming Language :: Python :: 2.7', 'Topic :: Internet :: WWW/HTTP', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', ], ) Fix bug when creating temporary URLs Pythons HMAC does not accept unicode, therefore converting key and hmac body to string (to be compatible with Python 2.x). Python 3 needs a byte conversion. See also: http://bugs.python.org/issue5285import os from setuptools import setup README = open(os.path.join(os.path.dirname(__file__), 'README.md')).read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='django-swiftbrowser', version='0.22', packages=['swiftbrowser'], include_package_data=True, license='Apache License (2.0)', description='A simple Django app to access Openstack Swift', long_description=README, url='https://github.com/cschwede/django-swiftbrowser', author='Christian Schwede', author_email='[email protected]', install_requires=['django>=1.5', 'python-swiftclient'], zip_safe=False, classifiers=[ 'Environment :: Web Environment', 'Framework :: Django', 'Intended Audience :: Developers', 'License :: OSI Approved :: Apache Software License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2.6', 'Programming Language :: Python :: 2.7', 'Topic :: Internet :: WWW/HTTP', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', ], )
<commit_before>import os from setuptools import setup README = open(os.path.join(os.path.dirname(__file__), 'README.md')).read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='django-swiftbrowser', version='0.21', packages=['swiftbrowser'], include_package_data=True, license='Apache License (2.0)', description='A simple Django app to access Openstack Swift', long_description=README, url='https://github.com/cschwede/django-swiftbrowser', author='Christian Schwede', author_email='[email protected]', install_requires=['django>=1.5', 'python-swiftclient'], zip_safe=False, classifiers=[ 'Environment :: Web Environment', 'Framework :: Django', 'Intended Audience :: Developers', 'License :: OSI Approved :: Apache Software License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2.6', 'Programming Language :: Python :: 2.7', 'Topic :: Internet :: WWW/HTTP', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', ], ) <commit_msg>Fix bug when creating temporary URLs Pythons HMAC does not accept unicode, therefore converting key and hmac body to string (to be compatible with Python 2.x). Python 3 needs a byte conversion. See also: http://bugs.python.org/issue5285<commit_after>import os from setuptools import setup README = open(os.path.join(os.path.dirname(__file__), 'README.md')).read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='django-swiftbrowser', version='0.22', packages=['swiftbrowser'], include_package_data=True, license='Apache License (2.0)', description='A simple Django app to access Openstack Swift', long_description=README, url='https://github.com/cschwede/django-swiftbrowser', author='Christian Schwede', author_email='[email protected]', install_requires=['django>=1.5', 'python-swiftclient'], zip_safe=False, classifiers=[ 'Environment :: Web Environment', 'Framework :: Django', 'Intended Audience :: Developers', 'License :: OSI Approved :: Apache Software License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2.6', 'Programming Language :: Python :: 2.7', 'Topic :: Internet :: WWW/HTTP', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', ], )
6ac11b95a10d8078774d3832aefb47ca3829d787
setup.py
setup.py
#!/usr/bin/env python from distutils.core import setup setup(name='redis-dump-load', version='0.4.0', description='Dump and load redis databases', author='Oleg Pudeyev', author_email='[email protected]', url='http://github.com/p/redis-dump-load', py_modules=['redisdl'], data_files=['LICENSE', 'README.rst'], )
#!/usr/bin/env python import os.path from distutils.core import setup package_name = 'redis-dump-load' package_version = '0.4.0' doc_dir = os.path.join('share', 'doc', package_name) data_files = ['LICENSE', 'README.rst'] setup(name=package_name, version=package_version, description='Dump and load redis databases', author='Oleg Pudeyev', author_email='[email protected]', url='http://github.com/p/redis-dump-load', py_modules=['redisdl'], data_files=[ (doc_dir, data_files), ], )
Put data files in doc dir
Put data files in doc dir
Python
bsd-2-clause
p/redis-dump-load,p/redis-dump-load
#!/usr/bin/env python from distutils.core import setup setup(name='redis-dump-load', version='0.4.0', description='Dump and load redis databases', author='Oleg Pudeyev', author_email='[email protected]', url='http://github.com/p/redis-dump-load', py_modules=['redisdl'], data_files=['LICENSE', 'README.rst'], ) Put data files in doc dir
#!/usr/bin/env python import os.path from distutils.core import setup package_name = 'redis-dump-load' package_version = '0.4.0' doc_dir = os.path.join('share', 'doc', package_name) data_files = ['LICENSE', 'README.rst'] setup(name=package_name, version=package_version, description='Dump and load redis databases', author='Oleg Pudeyev', author_email='[email protected]', url='http://github.com/p/redis-dump-load', py_modules=['redisdl'], data_files=[ (doc_dir, data_files), ], )
<commit_before>#!/usr/bin/env python from distutils.core import setup setup(name='redis-dump-load', version='0.4.0', description='Dump and load redis databases', author='Oleg Pudeyev', author_email='[email protected]', url='http://github.com/p/redis-dump-load', py_modules=['redisdl'], data_files=['LICENSE', 'README.rst'], ) <commit_msg>Put data files in doc dir<commit_after>
#!/usr/bin/env python import os.path from distutils.core import setup package_name = 'redis-dump-load' package_version = '0.4.0' doc_dir = os.path.join('share', 'doc', package_name) data_files = ['LICENSE', 'README.rst'] setup(name=package_name, version=package_version, description='Dump and load redis databases', author='Oleg Pudeyev', author_email='[email protected]', url='http://github.com/p/redis-dump-load', py_modules=['redisdl'], data_files=[ (doc_dir, data_files), ], )
#!/usr/bin/env python from distutils.core import setup setup(name='redis-dump-load', version='0.4.0', description='Dump and load redis databases', author='Oleg Pudeyev', author_email='[email protected]', url='http://github.com/p/redis-dump-load', py_modules=['redisdl'], data_files=['LICENSE', 'README.rst'], ) Put data files in doc dir#!/usr/bin/env python import os.path from distutils.core import setup package_name = 'redis-dump-load' package_version = '0.4.0' doc_dir = os.path.join('share', 'doc', package_name) data_files = ['LICENSE', 'README.rst'] setup(name=package_name, version=package_version, description='Dump and load redis databases', author='Oleg Pudeyev', author_email='[email protected]', url='http://github.com/p/redis-dump-load', py_modules=['redisdl'], data_files=[ (doc_dir, data_files), ], )
<commit_before>#!/usr/bin/env python from distutils.core import setup setup(name='redis-dump-load', version='0.4.0', description='Dump and load redis databases', author='Oleg Pudeyev', author_email='[email protected]', url='http://github.com/p/redis-dump-load', py_modules=['redisdl'], data_files=['LICENSE', 'README.rst'], ) <commit_msg>Put data files in doc dir<commit_after>#!/usr/bin/env python import os.path from distutils.core import setup package_name = 'redis-dump-load' package_version = '0.4.0' doc_dir = os.path.join('share', 'doc', package_name) data_files = ['LICENSE', 'README.rst'] setup(name=package_name, version=package_version, description='Dump and load redis databases', author='Oleg Pudeyev', author_email='[email protected]', url='http://github.com/p/redis-dump-load', py_modules=['redisdl'], data_files=[ (doc_dir, data_files), ], )
765e060897d7823547098d76afbfa72c0fdb191c
setup.py
setup.py
# # Initially copied from: # https://raw.githubusercontent.com/pypa/sampleproject/master/setup.py # from setuptools import setup, find_packages import os import codecs import __active_directory_version__ as __version__ here = os.path.abspath(os.path.dirname(__file__)) with codecs.open(os.path.join(here, 'README.rst'), encoding='utf-8') as f: long_description = f.read() setup( name='active_directory', version=__version__, description='Active Directory', long_description=long_description, url='https://github.com/tjguk/active_directory', author='Tim Golden', author_email='[email protected]', license='MIT', classifiers=[ 'Development Status :: 5 - Production/Stable', 'Environment :: Win32 (MS Windows)', 'Intended Audience :: Developers', 'Intended Audience :: System Administrators', "Programming Language :: Python :: 2", "Programming Language :: Python :: 3", 'License :: PSF', 'Natural Language :: English', 'Operating System :: Microsoft :: Windows :: Windows 95/98/2000', 'Topic :: System :: Systems Administration' ], py_modules=["active_directory", "__active_directory_version__"], )
# # Initially copied from: # https://raw.githubusercontent.com/pypa/sampleproject/master/setup.py # from setuptools import setup, find_packages import os import codecs import __active_directory_version__ as _version here = os.path.abspath(os.path.dirname(__file__)) with codecs.open(os.path.join(here, 'README.rst'), encoding='utf-8') as f: long_description = f.read() setup( name='active_directory', version=_version.__VERSION__, description='Active Directory', long_description=long_description, url='https://github.com/tjguk/active_directory', author='Tim Golden', author_email='[email protected]', license='MIT', classifiers=[ 'Development Status :: 5 - Production/Stable', 'Environment :: Win32 (MS Windows)', 'Intended Audience :: Developers', 'Intended Audience :: System Administrators', "Programming Language :: Python :: 2", "Programming Language :: Python :: 3", 'License :: PSF', 'Natural Language :: English', 'Operating System :: Microsoft :: Windows :: Windows 95/98/2000', 'Topic :: System :: Systems Administration' ], py_modules=["active_directory", "__active_directory_version__"], )
Sort out the mess with the version
Sort out the mess with the version
Python
mit
tjguk/active_directory
# # Initially copied from: # https://raw.githubusercontent.com/pypa/sampleproject/master/setup.py # from setuptools import setup, find_packages import os import codecs import __active_directory_version__ as __version__ here = os.path.abspath(os.path.dirname(__file__)) with codecs.open(os.path.join(here, 'README.rst'), encoding='utf-8') as f: long_description = f.read() setup( name='active_directory', version=__version__, description='Active Directory', long_description=long_description, url='https://github.com/tjguk/active_directory', author='Tim Golden', author_email='[email protected]', license='MIT', classifiers=[ 'Development Status :: 5 - Production/Stable', 'Environment :: Win32 (MS Windows)', 'Intended Audience :: Developers', 'Intended Audience :: System Administrators', "Programming Language :: Python :: 2", "Programming Language :: Python :: 3", 'License :: PSF', 'Natural Language :: English', 'Operating System :: Microsoft :: Windows :: Windows 95/98/2000', 'Topic :: System :: Systems Administration' ], py_modules=["active_directory", "__active_directory_version__"], ) Sort out the mess with the version
# # Initially copied from: # https://raw.githubusercontent.com/pypa/sampleproject/master/setup.py # from setuptools import setup, find_packages import os import codecs import __active_directory_version__ as _version here = os.path.abspath(os.path.dirname(__file__)) with codecs.open(os.path.join(here, 'README.rst'), encoding='utf-8') as f: long_description = f.read() setup( name='active_directory', version=_version.__VERSION__, description='Active Directory', long_description=long_description, url='https://github.com/tjguk/active_directory', author='Tim Golden', author_email='[email protected]', license='MIT', classifiers=[ 'Development Status :: 5 - Production/Stable', 'Environment :: Win32 (MS Windows)', 'Intended Audience :: Developers', 'Intended Audience :: System Administrators', "Programming Language :: Python :: 2", "Programming Language :: Python :: 3", 'License :: PSF', 'Natural Language :: English', 'Operating System :: Microsoft :: Windows :: Windows 95/98/2000', 'Topic :: System :: Systems Administration' ], py_modules=["active_directory", "__active_directory_version__"], )
<commit_before># # Initially copied from: # https://raw.githubusercontent.com/pypa/sampleproject/master/setup.py # from setuptools import setup, find_packages import os import codecs import __active_directory_version__ as __version__ here = os.path.abspath(os.path.dirname(__file__)) with codecs.open(os.path.join(here, 'README.rst'), encoding='utf-8') as f: long_description = f.read() setup( name='active_directory', version=__version__, description='Active Directory', long_description=long_description, url='https://github.com/tjguk/active_directory', author='Tim Golden', author_email='[email protected]', license='MIT', classifiers=[ 'Development Status :: 5 - Production/Stable', 'Environment :: Win32 (MS Windows)', 'Intended Audience :: Developers', 'Intended Audience :: System Administrators', "Programming Language :: Python :: 2", "Programming Language :: Python :: 3", 'License :: PSF', 'Natural Language :: English', 'Operating System :: Microsoft :: Windows :: Windows 95/98/2000', 'Topic :: System :: Systems Administration' ], py_modules=["active_directory", "__active_directory_version__"], ) <commit_msg>Sort out the mess with the version<commit_after>
# # Initially copied from: # https://raw.githubusercontent.com/pypa/sampleproject/master/setup.py # from setuptools import setup, find_packages import os import codecs import __active_directory_version__ as _version here = os.path.abspath(os.path.dirname(__file__)) with codecs.open(os.path.join(here, 'README.rst'), encoding='utf-8') as f: long_description = f.read() setup( name='active_directory', version=_version.__VERSION__, description='Active Directory', long_description=long_description, url='https://github.com/tjguk/active_directory', author='Tim Golden', author_email='[email protected]', license='MIT', classifiers=[ 'Development Status :: 5 - Production/Stable', 'Environment :: Win32 (MS Windows)', 'Intended Audience :: Developers', 'Intended Audience :: System Administrators', "Programming Language :: Python :: 2", "Programming Language :: Python :: 3", 'License :: PSF', 'Natural Language :: English', 'Operating System :: Microsoft :: Windows :: Windows 95/98/2000', 'Topic :: System :: Systems Administration' ], py_modules=["active_directory", "__active_directory_version__"], )
# # Initially copied from: # https://raw.githubusercontent.com/pypa/sampleproject/master/setup.py # from setuptools import setup, find_packages import os import codecs import __active_directory_version__ as __version__ here = os.path.abspath(os.path.dirname(__file__)) with codecs.open(os.path.join(here, 'README.rst'), encoding='utf-8') as f: long_description = f.read() setup( name='active_directory', version=__version__, description='Active Directory', long_description=long_description, url='https://github.com/tjguk/active_directory', author='Tim Golden', author_email='[email protected]', license='MIT', classifiers=[ 'Development Status :: 5 - Production/Stable', 'Environment :: Win32 (MS Windows)', 'Intended Audience :: Developers', 'Intended Audience :: System Administrators', "Programming Language :: Python :: 2", "Programming Language :: Python :: 3", 'License :: PSF', 'Natural Language :: English', 'Operating System :: Microsoft :: Windows :: Windows 95/98/2000', 'Topic :: System :: Systems Administration' ], py_modules=["active_directory", "__active_directory_version__"], ) Sort out the mess with the version# # Initially copied from: # https://raw.githubusercontent.com/pypa/sampleproject/master/setup.py # from setuptools import setup, find_packages import os import codecs import __active_directory_version__ as _version here = os.path.abspath(os.path.dirname(__file__)) with codecs.open(os.path.join(here, 'README.rst'), encoding='utf-8') as f: long_description = f.read() setup( name='active_directory', version=_version.__VERSION__, description='Active Directory', long_description=long_description, url='https://github.com/tjguk/active_directory', author='Tim Golden', author_email='[email protected]', license='MIT', classifiers=[ 'Development Status :: 5 - Production/Stable', 'Environment :: Win32 (MS Windows)', 'Intended Audience :: Developers', 'Intended Audience :: System Administrators', "Programming Language :: Python :: 2", "Programming Language :: Python :: 3", 'License :: PSF', 'Natural Language :: English', 'Operating System :: Microsoft :: Windows :: Windows 95/98/2000', 'Topic :: System :: Systems Administration' ], py_modules=["active_directory", "__active_directory_version__"], )
<commit_before># # Initially copied from: # https://raw.githubusercontent.com/pypa/sampleproject/master/setup.py # from setuptools import setup, find_packages import os import codecs import __active_directory_version__ as __version__ here = os.path.abspath(os.path.dirname(__file__)) with codecs.open(os.path.join(here, 'README.rst'), encoding='utf-8') as f: long_description = f.read() setup( name='active_directory', version=__version__, description='Active Directory', long_description=long_description, url='https://github.com/tjguk/active_directory', author='Tim Golden', author_email='[email protected]', license='MIT', classifiers=[ 'Development Status :: 5 - Production/Stable', 'Environment :: Win32 (MS Windows)', 'Intended Audience :: Developers', 'Intended Audience :: System Administrators', "Programming Language :: Python :: 2", "Programming Language :: Python :: 3", 'License :: PSF', 'Natural Language :: English', 'Operating System :: Microsoft :: Windows :: Windows 95/98/2000', 'Topic :: System :: Systems Administration' ], py_modules=["active_directory", "__active_directory_version__"], ) <commit_msg>Sort out the mess with the version<commit_after># # Initially copied from: # https://raw.githubusercontent.com/pypa/sampleproject/master/setup.py # from setuptools import setup, find_packages import os import codecs import __active_directory_version__ as _version here = os.path.abspath(os.path.dirname(__file__)) with codecs.open(os.path.join(here, 'README.rst'), encoding='utf-8') as f: long_description = f.read() setup( name='active_directory', version=_version.__VERSION__, description='Active Directory', long_description=long_description, url='https://github.com/tjguk/active_directory', author='Tim Golden', author_email='[email protected]', license='MIT', classifiers=[ 'Development Status :: 5 - Production/Stable', 'Environment :: Win32 (MS Windows)', 'Intended Audience :: Developers', 'Intended Audience :: System Administrators', "Programming Language :: Python :: 2", "Programming Language :: Python :: 3", 'License :: PSF', 'Natural Language :: English', 'Operating System :: Microsoft :: Windows :: Windows 95/98/2000', 'Topic :: System :: Systems Administration' ], py_modules=["active_directory", "__active_directory_version__"], )
5106630e2cca3b862838791535b922dc91458865
setup.py
setup.py
#!/usr/bin/env python from setuptools import setup, find_packages with open('VERSION') as version_stream: version = version_stream.read().strip() setup( name='PlayerPiano', version=version, description='Amazes your friends by running Python doctests in a fake interactive shell.', author='Peter Fein', author_email='[email protected]', url='https://github.com/wearpants/playerpiano', entry_points = { 'console_scripts': [ 'playerpiano=playerpiano.piano:main', 'recorderpiano=playerpiano.recorder:main', ]}, packages=find_packages(), include_package_data = True, install_requires=['pygments'], license="BSD", long_description=open("README.rst").read(), classifiers = [ "Development Status :: 5 - Production/Stable", "Environment :: Console", "Intended Audience :: Developers", "Operating System :: POSIX", "Topic :: Education :: Computer Aided Instruction (CAI)", "Topic :: System :: Shells", ], )
#!/usr/bin/env python from setuptools import setup, find_packages with open('VERSION') as version_stream: version = version_stream.read().strip() with open('README.rst') as readme_stream: readme = readme_stream.read() setup( name='PlayerPiano', version=version, description='Amazes your friends by running Python doctests in a fake interactive shell.', author='Peter Fein', author_email='[email protected]', url='https://github.com/wearpants/playerpiano', entry_points = { 'console_scripts': [ 'playerpiano=playerpiano.piano:main', 'recorderpiano=playerpiano.recorder:main', ]}, packages=find_packages(), include_package_data = True, install_requires=['pygments'], license="BSD", long_description=readme, classifiers = [ "Development Status :: 5 - Production/Stable", "Environment :: Console", "Intended Audience :: Developers", "Operating System :: POSIX", "Topic :: Education :: Computer Aided Instruction (CAI)", "Topic :: System :: Shells", ], )
Use open context to load readme (per best practices)
Use open context to load readme (per best practices)
Python
bsd-3-clause
wearpants/playerpiano
#!/usr/bin/env python from setuptools import setup, find_packages with open('VERSION') as version_stream: version = version_stream.read().strip() setup( name='PlayerPiano', version=version, description='Amazes your friends by running Python doctests in a fake interactive shell.', author='Peter Fein', author_email='[email protected]', url='https://github.com/wearpants/playerpiano', entry_points = { 'console_scripts': [ 'playerpiano=playerpiano.piano:main', 'recorderpiano=playerpiano.recorder:main', ]}, packages=find_packages(), include_package_data = True, install_requires=['pygments'], license="BSD", long_description=open("README.rst").read(), classifiers = [ "Development Status :: 5 - Production/Stable", "Environment :: Console", "Intended Audience :: Developers", "Operating System :: POSIX", "Topic :: Education :: Computer Aided Instruction (CAI)", "Topic :: System :: Shells", ], ) Use open context to load readme (per best practices)
#!/usr/bin/env python from setuptools import setup, find_packages with open('VERSION') as version_stream: version = version_stream.read().strip() with open('README.rst') as readme_stream: readme = readme_stream.read() setup( name='PlayerPiano', version=version, description='Amazes your friends by running Python doctests in a fake interactive shell.', author='Peter Fein', author_email='[email protected]', url='https://github.com/wearpants/playerpiano', entry_points = { 'console_scripts': [ 'playerpiano=playerpiano.piano:main', 'recorderpiano=playerpiano.recorder:main', ]}, packages=find_packages(), include_package_data = True, install_requires=['pygments'], license="BSD", long_description=readme, classifiers = [ "Development Status :: 5 - Production/Stable", "Environment :: Console", "Intended Audience :: Developers", "Operating System :: POSIX", "Topic :: Education :: Computer Aided Instruction (CAI)", "Topic :: System :: Shells", ], )
<commit_before>#!/usr/bin/env python from setuptools import setup, find_packages with open('VERSION') as version_stream: version = version_stream.read().strip() setup( name='PlayerPiano', version=version, description='Amazes your friends by running Python doctests in a fake interactive shell.', author='Peter Fein', author_email='[email protected]', url='https://github.com/wearpants/playerpiano', entry_points = { 'console_scripts': [ 'playerpiano=playerpiano.piano:main', 'recorderpiano=playerpiano.recorder:main', ]}, packages=find_packages(), include_package_data = True, install_requires=['pygments'], license="BSD", long_description=open("README.rst").read(), classifiers = [ "Development Status :: 5 - Production/Stable", "Environment :: Console", "Intended Audience :: Developers", "Operating System :: POSIX", "Topic :: Education :: Computer Aided Instruction (CAI)", "Topic :: System :: Shells", ], ) <commit_msg>Use open context to load readme (per best practices)<commit_after>
#!/usr/bin/env python from setuptools import setup, find_packages with open('VERSION') as version_stream: version = version_stream.read().strip() with open('README.rst') as readme_stream: readme = readme_stream.read() setup( name='PlayerPiano', version=version, description='Amazes your friends by running Python doctests in a fake interactive shell.', author='Peter Fein', author_email='[email protected]', url='https://github.com/wearpants/playerpiano', entry_points = { 'console_scripts': [ 'playerpiano=playerpiano.piano:main', 'recorderpiano=playerpiano.recorder:main', ]}, packages=find_packages(), include_package_data = True, install_requires=['pygments'], license="BSD", long_description=readme, classifiers = [ "Development Status :: 5 - Production/Stable", "Environment :: Console", "Intended Audience :: Developers", "Operating System :: POSIX", "Topic :: Education :: Computer Aided Instruction (CAI)", "Topic :: System :: Shells", ], )
#!/usr/bin/env python from setuptools import setup, find_packages with open('VERSION') as version_stream: version = version_stream.read().strip() setup( name='PlayerPiano', version=version, description='Amazes your friends by running Python doctests in a fake interactive shell.', author='Peter Fein', author_email='[email protected]', url='https://github.com/wearpants/playerpiano', entry_points = { 'console_scripts': [ 'playerpiano=playerpiano.piano:main', 'recorderpiano=playerpiano.recorder:main', ]}, packages=find_packages(), include_package_data = True, install_requires=['pygments'], license="BSD", long_description=open("README.rst").read(), classifiers = [ "Development Status :: 5 - Production/Stable", "Environment :: Console", "Intended Audience :: Developers", "Operating System :: POSIX", "Topic :: Education :: Computer Aided Instruction (CAI)", "Topic :: System :: Shells", ], ) Use open context to load readme (per best practices)#!/usr/bin/env python from setuptools import setup, find_packages with open('VERSION') as version_stream: version = version_stream.read().strip() with open('README.rst') as readme_stream: readme = readme_stream.read() setup( name='PlayerPiano', version=version, description='Amazes your friends by running Python doctests in a fake interactive shell.', author='Peter Fein', author_email='[email protected]', url='https://github.com/wearpants/playerpiano', entry_points = { 'console_scripts': [ 'playerpiano=playerpiano.piano:main', 'recorderpiano=playerpiano.recorder:main', ]}, packages=find_packages(), include_package_data = True, install_requires=['pygments'], license="BSD", long_description=readme, classifiers = [ "Development Status :: 5 - Production/Stable", "Environment :: Console", "Intended Audience :: Developers", "Operating System :: POSIX", "Topic :: Education :: Computer Aided Instruction (CAI)", "Topic :: System :: Shells", ], )
<commit_before>#!/usr/bin/env python from setuptools import setup, find_packages with open('VERSION') as version_stream: version = version_stream.read().strip() setup( name='PlayerPiano', version=version, description='Amazes your friends by running Python doctests in a fake interactive shell.', author='Peter Fein', author_email='[email protected]', url='https://github.com/wearpants/playerpiano', entry_points = { 'console_scripts': [ 'playerpiano=playerpiano.piano:main', 'recorderpiano=playerpiano.recorder:main', ]}, packages=find_packages(), include_package_data = True, install_requires=['pygments'], license="BSD", long_description=open("README.rst").read(), classifiers = [ "Development Status :: 5 - Production/Stable", "Environment :: Console", "Intended Audience :: Developers", "Operating System :: POSIX", "Topic :: Education :: Computer Aided Instruction (CAI)", "Topic :: System :: Shells", ], ) <commit_msg>Use open context to load readme (per best practices)<commit_after>#!/usr/bin/env python from setuptools import setup, find_packages with open('VERSION') as version_stream: version = version_stream.read().strip() with open('README.rst') as readme_stream: readme = readme_stream.read() setup( name='PlayerPiano', version=version, description='Amazes your friends by running Python doctests in a fake interactive shell.', author='Peter Fein', author_email='[email protected]', url='https://github.com/wearpants/playerpiano', entry_points = { 'console_scripts': [ 'playerpiano=playerpiano.piano:main', 'recorderpiano=playerpiano.recorder:main', ]}, packages=find_packages(), include_package_data = True, install_requires=['pygments'], license="BSD", long_description=readme, classifiers = [ "Development Status :: 5 - Production/Stable", "Environment :: Console", "Intended Audience :: Developers", "Operating System :: POSIX", "Topic :: Education :: Computer Aided Instruction (CAI)", "Topic :: System :: Shells", ], )
0b7df5832eba167401604c895fb8cad6eb8c1722
setup.py
setup.py
""" Publish a new version: $ git tag X.Y.Z -m "Release X.Y.Z" $ git push --tags $ pip install --upgrade twine wheel $ python setup.py sdist bdist_wheel $ twine upload dist/* """ import codecs import os import sys from setuptools import setup SCHEDULE_VERSION = '0.4.0' SCHEDULE_DOWNLOAD_URL = ( 'https://github.com/dbader/schedule/tarball/' + SCHEDULE_VERSION ) def read_file(filename): """ Read a utf8 encoded text file and return its contents. """ with codecs.open(filename, 'r', 'utf8') as f: return f.read() setup( name='schedule', packages=['schedule'], version=SCHEDULE_VERSION, description='Job scheduling for humans.', long_description=( read_file('README.rst') + '\n\n' + read_file('HISTORY.rst') ), license=read_file('LICENSE.txt'), author='Daniel Bader', author_email='[email protected]', url='https://github.com/dbader/schedule', download_url=SCHEDULE_DOWNLOAD_URL, keywords=[ 'schedule', 'periodic', 'jobs', 'scheduling', 'clockwork', 'cron' ], classifiers=[ 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3.5', 'Natural Language :: English', ], )
""" Publish a new version: $ git tag X.Y.Z -m "Release X.Y.Z" $ git push --tags $ pip install --upgrade twine wheel $ python setup.py sdist bdist_wheel $ twine upload dist/* """ import codecs import os import sys from setuptools import setup SCHEDULE_VERSION = '0.4.1' SCHEDULE_DOWNLOAD_URL = ( 'https://github.com/dbader/schedule/tarball/' + SCHEDULE_VERSION ) def read_file(filename): """ Read a utf8 encoded text file and return its contents. """ with codecs.open(filename, 'r', 'utf8') as f: return f.read() setup( name='schedule', packages=['schedule'], version=SCHEDULE_VERSION, description='Job scheduling for humans.', long_description=read_file('README.rst'), license='MIT', author='Daniel Bader', author_email='[email protected]', url='https://github.com/dbader/schedule', download_url=SCHEDULE_DOWNLOAD_URL, keywords=[ 'schedule', 'periodic', 'jobs', 'scheduling', 'clockwork', 'cron' ], classifiers=[ 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3.5', 'Natural Language :: English', ], )
Fix README.rst rendering on PyPI
Fix README.rst rendering on PyPI
Python
mit
dbader/schedule
""" Publish a new version: $ git tag X.Y.Z -m "Release X.Y.Z" $ git push --tags $ pip install --upgrade twine wheel $ python setup.py sdist bdist_wheel $ twine upload dist/* """ import codecs import os import sys from setuptools import setup SCHEDULE_VERSION = '0.4.0' SCHEDULE_DOWNLOAD_URL = ( 'https://github.com/dbader/schedule/tarball/' + SCHEDULE_VERSION ) def read_file(filename): """ Read a utf8 encoded text file and return its contents. """ with codecs.open(filename, 'r', 'utf8') as f: return f.read() setup( name='schedule', packages=['schedule'], version=SCHEDULE_VERSION, description='Job scheduling for humans.', long_description=( read_file('README.rst') + '\n\n' + read_file('HISTORY.rst') ), license=read_file('LICENSE.txt'), author='Daniel Bader', author_email='[email protected]', url='https://github.com/dbader/schedule', download_url=SCHEDULE_DOWNLOAD_URL, keywords=[ 'schedule', 'periodic', 'jobs', 'scheduling', 'clockwork', 'cron' ], classifiers=[ 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3.5', 'Natural Language :: English', ], ) Fix README.rst rendering on PyPI
""" Publish a new version: $ git tag X.Y.Z -m "Release X.Y.Z" $ git push --tags $ pip install --upgrade twine wheel $ python setup.py sdist bdist_wheel $ twine upload dist/* """ import codecs import os import sys from setuptools import setup SCHEDULE_VERSION = '0.4.1' SCHEDULE_DOWNLOAD_URL = ( 'https://github.com/dbader/schedule/tarball/' + SCHEDULE_VERSION ) def read_file(filename): """ Read a utf8 encoded text file and return its contents. """ with codecs.open(filename, 'r', 'utf8') as f: return f.read() setup( name='schedule', packages=['schedule'], version=SCHEDULE_VERSION, description='Job scheduling for humans.', long_description=read_file('README.rst'), license='MIT', author='Daniel Bader', author_email='[email protected]', url='https://github.com/dbader/schedule', download_url=SCHEDULE_DOWNLOAD_URL, keywords=[ 'schedule', 'periodic', 'jobs', 'scheduling', 'clockwork', 'cron' ], classifiers=[ 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3.5', 'Natural Language :: English', ], )
<commit_before>""" Publish a new version: $ git tag X.Y.Z -m "Release X.Y.Z" $ git push --tags $ pip install --upgrade twine wheel $ python setup.py sdist bdist_wheel $ twine upload dist/* """ import codecs import os import sys from setuptools import setup SCHEDULE_VERSION = '0.4.0' SCHEDULE_DOWNLOAD_URL = ( 'https://github.com/dbader/schedule/tarball/' + SCHEDULE_VERSION ) def read_file(filename): """ Read a utf8 encoded text file and return its contents. """ with codecs.open(filename, 'r', 'utf8') as f: return f.read() setup( name='schedule', packages=['schedule'], version=SCHEDULE_VERSION, description='Job scheduling for humans.', long_description=( read_file('README.rst') + '\n\n' + read_file('HISTORY.rst') ), license=read_file('LICENSE.txt'), author='Daniel Bader', author_email='[email protected]', url='https://github.com/dbader/schedule', download_url=SCHEDULE_DOWNLOAD_URL, keywords=[ 'schedule', 'periodic', 'jobs', 'scheduling', 'clockwork', 'cron' ], classifiers=[ 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3.5', 'Natural Language :: English', ], ) <commit_msg>Fix README.rst rendering on PyPI<commit_after>
""" Publish a new version: $ git tag X.Y.Z -m "Release X.Y.Z" $ git push --tags $ pip install --upgrade twine wheel $ python setup.py sdist bdist_wheel $ twine upload dist/* """ import codecs import os import sys from setuptools import setup SCHEDULE_VERSION = '0.4.1' SCHEDULE_DOWNLOAD_URL = ( 'https://github.com/dbader/schedule/tarball/' + SCHEDULE_VERSION ) def read_file(filename): """ Read a utf8 encoded text file and return its contents. """ with codecs.open(filename, 'r', 'utf8') as f: return f.read() setup( name='schedule', packages=['schedule'], version=SCHEDULE_VERSION, description='Job scheduling for humans.', long_description=read_file('README.rst'), license='MIT', author='Daniel Bader', author_email='[email protected]', url='https://github.com/dbader/schedule', download_url=SCHEDULE_DOWNLOAD_URL, keywords=[ 'schedule', 'periodic', 'jobs', 'scheduling', 'clockwork', 'cron' ], classifiers=[ 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3.5', 'Natural Language :: English', ], )
""" Publish a new version: $ git tag X.Y.Z -m "Release X.Y.Z" $ git push --tags $ pip install --upgrade twine wheel $ python setup.py sdist bdist_wheel $ twine upload dist/* """ import codecs import os import sys from setuptools import setup SCHEDULE_VERSION = '0.4.0' SCHEDULE_DOWNLOAD_URL = ( 'https://github.com/dbader/schedule/tarball/' + SCHEDULE_VERSION ) def read_file(filename): """ Read a utf8 encoded text file and return its contents. """ with codecs.open(filename, 'r', 'utf8') as f: return f.read() setup( name='schedule', packages=['schedule'], version=SCHEDULE_VERSION, description='Job scheduling for humans.', long_description=( read_file('README.rst') + '\n\n' + read_file('HISTORY.rst') ), license=read_file('LICENSE.txt'), author='Daniel Bader', author_email='[email protected]', url='https://github.com/dbader/schedule', download_url=SCHEDULE_DOWNLOAD_URL, keywords=[ 'schedule', 'periodic', 'jobs', 'scheduling', 'clockwork', 'cron' ], classifiers=[ 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3.5', 'Natural Language :: English', ], ) Fix README.rst rendering on PyPI""" Publish a new version: $ git tag X.Y.Z -m "Release X.Y.Z" $ git push --tags $ pip install --upgrade twine wheel $ python setup.py sdist bdist_wheel $ twine upload dist/* """ import codecs import os import sys from setuptools import setup SCHEDULE_VERSION = '0.4.1' SCHEDULE_DOWNLOAD_URL = ( 'https://github.com/dbader/schedule/tarball/' + SCHEDULE_VERSION ) def read_file(filename): """ Read a utf8 encoded text file and return its contents. """ with codecs.open(filename, 'r', 'utf8') as f: return f.read() setup( name='schedule', packages=['schedule'], version=SCHEDULE_VERSION, description='Job scheduling for humans.', long_description=read_file('README.rst'), license='MIT', author='Daniel Bader', author_email='[email protected]', url='https://github.com/dbader/schedule', download_url=SCHEDULE_DOWNLOAD_URL, keywords=[ 'schedule', 'periodic', 'jobs', 'scheduling', 'clockwork', 'cron' ], classifiers=[ 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3.5', 'Natural Language :: English', ], )
<commit_before>""" Publish a new version: $ git tag X.Y.Z -m "Release X.Y.Z" $ git push --tags $ pip install --upgrade twine wheel $ python setup.py sdist bdist_wheel $ twine upload dist/* """ import codecs import os import sys from setuptools import setup SCHEDULE_VERSION = '0.4.0' SCHEDULE_DOWNLOAD_URL = ( 'https://github.com/dbader/schedule/tarball/' + SCHEDULE_VERSION ) def read_file(filename): """ Read a utf8 encoded text file and return its contents. """ with codecs.open(filename, 'r', 'utf8') as f: return f.read() setup( name='schedule', packages=['schedule'], version=SCHEDULE_VERSION, description='Job scheduling for humans.', long_description=( read_file('README.rst') + '\n\n' + read_file('HISTORY.rst') ), license=read_file('LICENSE.txt'), author='Daniel Bader', author_email='[email protected]', url='https://github.com/dbader/schedule', download_url=SCHEDULE_DOWNLOAD_URL, keywords=[ 'schedule', 'periodic', 'jobs', 'scheduling', 'clockwork', 'cron' ], classifiers=[ 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3.5', 'Natural Language :: English', ], ) <commit_msg>Fix README.rst rendering on PyPI<commit_after>""" Publish a new version: $ git tag X.Y.Z -m "Release X.Y.Z" $ git push --tags $ pip install --upgrade twine wheel $ python setup.py sdist bdist_wheel $ twine upload dist/* """ import codecs import os import sys from setuptools import setup SCHEDULE_VERSION = '0.4.1' SCHEDULE_DOWNLOAD_URL = ( 'https://github.com/dbader/schedule/tarball/' + SCHEDULE_VERSION ) def read_file(filename): """ Read a utf8 encoded text file and return its contents. """ with codecs.open(filename, 'r', 'utf8') as f: return f.read() setup( name='schedule', packages=['schedule'], version=SCHEDULE_VERSION, description='Job scheduling for humans.', long_description=read_file('README.rst'), license='MIT', author='Daniel Bader', author_email='[email protected]', url='https://github.com/dbader/schedule', download_url=SCHEDULE_DOWNLOAD_URL, keywords=[ 'schedule', 'periodic', 'jobs', 'scheduling', 'clockwork', 'cron' ], classifiers=[ 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3.5', 'Natural Language :: English', ], )
9b72a221461c05b6c395f28e5b3d241afa156820
setup.py
setup.py
#!/usr/bin/env python from setuptools import setup def read(name): from os import path return open(path.join(path.dirname(__file__), name)).read() setup( name='django-facebook-auth', version='3.6.0', description="Authorisation app for Facebook API.", long_description=read("README.rst"), maintainer="Tomasz Wysocki", maintainer_email="[email protected]", install_requires=( 'celery', 'Django<1.8', 'facepy>=1.0.3', ), packages=[ 'facebook_auth', 'facebook_auth.migrations', 'facebook_auth.management', 'facebook_auth.management.commands', ], )
#!/usr/bin/env python from setuptools import setup def read(name): from os import path return open(path.join(path.dirname(__file__), name)).read() setup( name='django-facebook-auth', version='3.6.1', description="Authorisation app for Facebook API.", long_description=read("README.rst"), maintainer="Tomasz Wysocki", maintainer_email="[email protected]", install_requires=( 'celery', 'Django<1.8', 'facepy>=1.0.3', ), packages=[ 'facebook_auth', 'facebook_auth.migrations', 'facebook_auth.management', 'facebook_auth.management.commands', 'facebook_auth.south_migrations', ], )
Include south migration in package.
Include south migration in package.
Python
mit
jgoclawski/django-facebook-auth,jgoclawski/django-facebook-auth,pozytywnie/django-facebook-auth,pozytywnie/django-facebook-auth
#!/usr/bin/env python from setuptools import setup def read(name): from os import path return open(path.join(path.dirname(__file__), name)).read() setup( name='django-facebook-auth', version='3.6.0', description="Authorisation app for Facebook API.", long_description=read("README.rst"), maintainer="Tomasz Wysocki", maintainer_email="[email protected]", install_requires=( 'celery', 'Django<1.8', 'facepy>=1.0.3', ), packages=[ 'facebook_auth', 'facebook_auth.migrations', 'facebook_auth.management', 'facebook_auth.management.commands', ], ) Include south migration in package.
#!/usr/bin/env python from setuptools import setup def read(name): from os import path return open(path.join(path.dirname(__file__), name)).read() setup( name='django-facebook-auth', version='3.6.1', description="Authorisation app for Facebook API.", long_description=read("README.rst"), maintainer="Tomasz Wysocki", maintainer_email="[email protected]", install_requires=( 'celery', 'Django<1.8', 'facepy>=1.0.3', ), packages=[ 'facebook_auth', 'facebook_auth.migrations', 'facebook_auth.management', 'facebook_auth.management.commands', 'facebook_auth.south_migrations', ], )
<commit_before>#!/usr/bin/env python from setuptools import setup def read(name): from os import path return open(path.join(path.dirname(__file__), name)).read() setup( name='django-facebook-auth', version='3.6.0', description="Authorisation app for Facebook API.", long_description=read("README.rst"), maintainer="Tomasz Wysocki", maintainer_email="[email protected]", install_requires=( 'celery', 'Django<1.8', 'facepy>=1.0.3', ), packages=[ 'facebook_auth', 'facebook_auth.migrations', 'facebook_auth.management', 'facebook_auth.management.commands', ], ) <commit_msg>Include south migration in package.<commit_after>
#!/usr/bin/env python from setuptools import setup def read(name): from os import path return open(path.join(path.dirname(__file__), name)).read() setup( name='django-facebook-auth', version='3.6.1', description="Authorisation app for Facebook API.", long_description=read("README.rst"), maintainer="Tomasz Wysocki", maintainer_email="[email protected]", install_requires=( 'celery', 'Django<1.8', 'facepy>=1.0.3', ), packages=[ 'facebook_auth', 'facebook_auth.migrations', 'facebook_auth.management', 'facebook_auth.management.commands', 'facebook_auth.south_migrations', ], )
#!/usr/bin/env python from setuptools import setup def read(name): from os import path return open(path.join(path.dirname(__file__), name)).read() setup( name='django-facebook-auth', version='3.6.0', description="Authorisation app for Facebook API.", long_description=read("README.rst"), maintainer="Tomasz Wysocki", maintainer_email="[email protected]", install_requires=( 'celery', 'Django<1.8', 'facepy>=1.0.3', ), packages=[ 'facebook_auth', 'facebook_auth.migrations', 'facebook_auth.management', 'facebook_auth.management.commands', ], ) Include south migration in package.#!/usr/bin/env python from setuptools import setup def read(name): from os import path return open(path.join(path.dirname(__file__), name)).read() setup( name='django-facebook-auth', version='3.6.1', description="Authorisation app for Facebook API.", long_description=read("README.rst"), maintainer="Tomasz Wysocki", maintainer_email="[email protected]", install_requires=( 'celery', 'Django<1.8', 'facepy>=1.0.3', ), packages=[ 'facebook_auth', 'facebook_auth.migrations', 'facebook_auth.management', 'facebook_auth.management.commands', 'facebook_auth.south_migrations', ], )
<commit_before>#!/usr/bin/env python from setuptools import setup def read(name): from os import path return open(path.join(path.dirname(__file__), name)).read() setup( name='django-facebook-auth', version='3.6.0', description="Authorisation app for Facebook API.", long_description=read("README.rst"), maintainer="Tomasz Wysocki", maintainer_email="[email protected]", install_requires=( 'celery', 'Django<1.8', 'facepy>=1.0.3', ), packages=[ 'facebook_auth', 'facebook_auth.migrations', 'facebook_auth.management', 'facebook_auth.management.commands', ], ) <commit_msg>Include south migration in package.<commit_after>#!/usr/bin/env python from setuptools import setup def read(name): from os import path return open(path.join(path.dirname(__file__), name)).read() setup( name='django-facebook-auth', version='3.6.1', description="Authorisation app for Facebook API.", long_description=read("README.rst"), maintainer="Tomasz Wysocki", maintainer_email="[email protected]", install_requires=( 'celery', 'Django<1.8', 'facepy>=1.0.3', ), packages=[ 'facebook_auth', 'facebook_auth.migrations', 'facebook_auth.management', 'facebook_auth.management.commands', 'facebook_auth.south_migrations', ], )
798d62dc45916b691b2e47ace649771b7de13ba0
setup.py
setup.py
import os from setuptools import find_packages, setup with open(os.path.join(os.path.dirname(__file__), 'README.rst')) as readme: README = readme.read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='wagtail-tinify', version='0.1', packages=find_packages(), include_package_data=True, license='MIT License', # example license description='A simple Django app optimize Wagtail Renditions using TinyPNG', long_description=README, url='https://www.example.com/', author='Overcast Software', author_email='[email protected]', classifiers=[ 'Environment :: Web Environment', 'Framework :: Django', 'Intended Audience :: Developers', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Internet :: WWW/HTTP', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', ], install_requires=[ "wagtail>=1.6.0", "Django>=1.7.1", "tinify", "cloudflare" ], )
import os from setuptools import find_packages, setup with open(os.path.join(os.path.dirname(__file__), 'README.rst')) as readme: README = readme.read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='wagtail-tinify', version='0.1', packages=find_packages(), include_package_data=True, license='MIT License', # example license description='A simple Django app optimize Wagtail Renditions using TinyPNG', long_description=README, url='https://www.example.com/', author='Overcast Software', author_email='[email protected]', classifiers=[ 'Environment :: Web Environment', 'Framework :: Django', 'Intended Audience :: Developers', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Internet :: WWW/HTTP', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', ], install_requires=[ "tinify", "cloudflare" ], )
Remove specific versions of dependencies
Remove specific versions of dependencies
Python
mit
overcastsoftware/wagtail-tinify
import os from setuptools import find_packages, setup with open(os.path.join(os.path.dirname(__file__), 'README.rst')) as readme: README = readme.read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='wagtail-tinify', version='0.1', packages=find_packages(), include_package_data=True, license='MIT License', # example license description='A simple Django app optimize Wagtail Renditions using TinyPNG', long_description=README, url='https://www.example.com/', author='Overcast Software', author_email='[email protected]', classifiers=[ 'Environment :: Web Environment', 'Framework :: Django', 'Intended Audience :: Developers', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Internet :: WWW/HTTP', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', ], install_requires=[ "wagtail>=1.6.0", "Django>=1.7.1", "tinify", "cloudflare" ], )Remove specific versions of dependencies
import os from setuptools import find_packages, setup with open(os.path.join(os.path.dirname(__file__), 'README.rst')) as readme: README = readme.read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='wagtail-tinify', version='0.1', packages=find_packages(), include_package_data=True, license='MIT License', # example license description='A simple Django app optimize Wagtail Renditions using TinyPNG', long_description=README, url='https://www.example.com/', author='Overcast Software', author_email='[email protected]', classifiers=[ 'Environment :: Web Environment', 'Framework :: Django', 'Intended Audience :: Developers', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Internet :: WWW/HTTP', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', ], install_requires=[ "tinify", "cloudflare" ], )
<commit_before>import os from setuptools import find_packages, setup with open(os.path.join(os.path.dirname(__file__), 'README.rst')) as readme: README = readme.read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='wagtail-tinify', version='0.1', packages=find_packages(), include_package_data=True, license='MIT License', # example license description='A simple Django app optimize Wagtail Renditions using TinyPNG', long_description=README, url='https://www.example.com/', author='Overcast Software', author_email='[email protected]', classifiers=[ 'Environment :: Web Environment', 'Framework :: Django', 'Intended Audience :: Developers', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Internet :: WWW/HTTP', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', ], install_requires=[ "wagtail>=1.6.0", "Django>=1.7.1", "tinify", "cloudflare" ], )<commit_msg>Remove specific versions of dependencies<commit_after>
import os from setuptools import find_packages, setup with open(os.path.join(os.path.dirname(__file__), 'README.rst')) as readme: README = readme.read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='wagtail-tinify', version='0.1', packages=find_packages(), include_package_data=True, license='MIT License', # example license description='A simple Django app optimize Wagtail Renditions using TinyPNG', long_description=README, url='https://www.example.com/', author='Overcast Software', author_email='[email protected]', classifiers=[ 'Environment :: Web Environment', 'Framework :: Django', 'Intended Audience :: Developers', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Internet :: WWW/HTTP', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', ], install_requires=[ "tinify", "cloudflare" ], )
import os from setuptools import find_packages, setup with open(os.path.join(os.path.dirname(__file__), 'README.rst')) as readme: README = readme.read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='wagtail-tinify', version='0.1', packages=find_packages(), include_package_data=True, license='MIT License', # example license description='A simple Django app optimize Wagtail Renditions using TinyPNG', long_description=README, url='https://www.example.com/', author='Overcast Software', author_email='[email protected]', classifiers=[ 'Environment :: Web Environment', 'Framework :: Django', 'Intended Audience :: Developers', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Internet :: WWW/HTTP', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', ], install_requires=[ "wagtail>=1.6.0", "Django>=1.7.1", "tinify", "cloudflare" ], )Remove specific versions of dependenciesimport os from setuptools import find_packages, setup with open(os.path.join(os.path.dirname(__file__), 'README.rst')) as readme: README = readme.read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='wagtail-tinify', version='0.1', packages=find_packages(), include_package_data=True, license='MIT License', # example license description='A simple Django app optimize Wagtail Renditions using TinyPNG', long_description=README, url='https://www.example.com/', author='Overcast Software', author_email='[email protected]', classifiers=[ 'Environment :: Web Environment', 'Framework :: Django', 'Intended Audience :: Developers', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Internet :: WWW/HTTP', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', ], install_requires=[ "tinify", "cloudflare" ], )
<commit_before>import os from setuptools import find_packages, setup with open(os.path.join(os.path.dirname(__file__), 'README.rst')) as readme: README = readme.read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='wagtail-tinify', version='0.1', packages=find_packages(), include_package_data=True, license='MIT License', # example license description='A simple Django app optimize Wagtail Renditions using TinyPNG', long_description=README, url='https://www.example.com/', author='Overcast Software', author_email='[email protected]', classifiers=[ 'Environment :: Web Environment', 'Framework :: Django', 'Intended Audience :: Developers', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Internet :: WWW/HTTP', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', ], install_requires=[ "wagtail>=1.6.0", "Django>=1.7.1", "tinify", "cloudflare" ], )<commit_msg>Remove specific versions of dependencies<commit_after>import os from setuptools import find_packages, setup with open(os.path.join(os.path.dirname(__file__), 'README.rst')) as readme: README = readme.read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='wagtail-tinify', version='0.1', packages=find_packages(), include_package_data=True, license='MIT License', # example license description='A simple Django app optimize Wagtail Renditions using TinyPNG', long_description=README, url='https://www.example.com/', author='Overcast Software', author_email='[email protected]', classifiers=[ 'Environment :: Web Environment', 'Framework :: Django', 'Intended Audience :: Developers', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Internet :: WWW/HTTP', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', ], install_requires=[ "tinify", "cloudflare" ], )
56d34a3b12fc65f291d6779a5a0e5e84036f52be
setup.py
setup.py
""" pypebbleapi ------------ Pebble-api for python. Library to ease the access to the Pebble Timeline and the creation of Pins. """ from setuptools import setup, find_packages setup( name='pypebbleapi', version='0.1.0', url='https://github.com/youtux/pypebbleapi', license='MIT', author='Alessio Bogon', author_email='[email protected]', description='Pebble-api for python.', long_description=__doc__, packages=find_packages(), install_requires=['requests~=2.6', 'six~=1.9', 'Cerberus~=0.9'], classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Topic :: Software Development :: Libraries :: Python Modules', ] )
""" pypebbleapi ------------ Pebble-api for python. Library to ease the access to the Pebble Timeline and the creation of Pins. """ from setuptools import setup, find_packages setup( name='pypebbleapi', version='0.1.0', url='https://github.com/youtux/pypebbleapi', license='MIT', author='Alessio Bogon', author_email='[email protected]', description='Pebble-api for python.', long_description=__doc__, packages=find_packages(), install_requires=['requests~=2.6', 'six~=1.9', 'Cerberus~=0.9'], classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', 'Topic :: Software Development :: Libraries :: Python Modules', ] )
Declare support for python 3.5
Declare support for python 3.5
Python
mit
youtux/pypebbleapi
""" pypebbleapi ------------ Pebble-api for python. Library to ease the access to the Pebble Timeline and the creation of Pins. """ from setuptools import setup, find_packages setup( name='pypebbleapi', version='0.1.0', url='https://github.com/youtux/pypebbleapi', license='MIT', author='Alessio Bogon', author_email='[email protected]', description='Pebble-api for python.', long_description=__doc__, packages=find_packages(), install_requires=['requests~=2.6', 'six~=1.9', 'Cerberus~=0.9'], classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Topic :: Software Development :: Libraries :: Python Modules', ] ) Declare support for python 3.5
""" pypebbleapi ------------ Pebble-api for python. Library to ease the access to the Pebble Timeline and the creation of Pins. """ from setuptools import setup, find_packages setup( name='pypebbleapi', version='0.1.0', url='https://github.com/youtux/pypebbleapi', license='MIT', author='Alessio Bogon', author_email='[email protected]', description='Pebble-api for python.', long_description=__doc__, packages=find_packages(), install_requires=['requests~=2.6', 'six~=1.9', 'Cerberus~=0.9'], classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', 'Topic :: Software Development :: Libraries :: Python Modules', ] )
<commit_before>""" pypebbleapi ------------ Pebble-api for python. Library to ease the access to the Pebble Timeline and the creation of Pins. """ from setuptools import setup, find_packages setup( name='pypebbleapi', version='0.1.0', url='https://github.com/youtux/pypebbleapi', license='MIT', author='Alessio Bogon', author_email='[email protected]', description='Pebble-api for python.', long_description=__doc__, packages=find_packages(), install_requires=['requests~=2.6', 'six~=1.9', 'Cerberus~=0.9'], classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Topic :: Software Development :: Libraries :: Python Modules', ] ) <commit_msg>Declare support for python 3.5<commit_after>
""" pypebbleapi ------------ Pebble-api for python. Library to ease the access to the Pebble Timeline and the creation of Pins. """ from setuptools import setup, find_packages setup( name='pypebbleapi', version='0.1.0', url='https://github.com/youtux/pypebbleapi', license='MIT', author='Alessio Bogon', author_email='[email protected]', description='Pebble-api for python.', long_description=__doc__, packages=find_packages(), install_requires=['requests~=2.6', 'six~=1.9', 'Cerberus~=0.9'], classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', 'Topic :: Software Development :: Libraries :: Python Modules', ] )
""" pypebbleapi ------------ Pebble-api for python. Library to ease the access to the Pebble Timeline and the creation of Pins. """ from setuptools import setup, find_packages setup( name='pypebbleapi', version='0.1.0', url='https://github.com/youtux/pypebbleapi', license='MIT', author='Alessio Bogon', author_email='[email protected]', description='Pebble-api for python.', long_description=__doc__, packages=find_packages(), install_requires=['requests~=2.6', 'six~=1.9', 'Cerberus~=0.9'], classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Topic :: Software Development :: Libraries :: Python Modules', ] ) Declare support for python 3.5""" pypebbleapi ------------ Pebble-api for python. Library to ease the access to the Pebble Timeline and the creation of Pins. """ from setuptools import setup, find_packages setup( name='pypebbleapi', version='0.1.0', url='https://github.com/youtux/pypebbleapi', license='MIT', author='Alessio Bogon', author_email='[email protected]', description='Pebble-api for python.', long_description=__doc__, packages=find_packages(), install_requires=['requests~=2.6', 'six~=1.9', 'Cerberus~=0.9'], classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', 'Topic :: Software Development :: Libraries :: Python Modules', ] )
<commit_before>""" pypebbleapi ------------ Pebble-api for python. Library to ease the access to the Pebble Timeline and the creation of Pins. """ from setuptools import setup, find_packages setup( name='pypebbleapi', version='0.1.0', url='https://github.com/youtux/pypebbleapi', license='MIT', author='Alessio Bogon', author_email='[email protected]', description='Pebble-api for python.', long_description=__doc__, packages=find_packages(), install_requires=['requests~=2.6', 'six~=1.9', 'Cerberus~=0.9'], classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Topic :: Software Development :: Libraries :: Python Modules', ] ) <commit_msg>Declare support for python 3.5<commit_after>""" pypebbleapi ------------ Pebble-api for python. Library to ease the access to the Pebble Timeline and the creation of Pins. """ from setuptools import setup, find_packages setup( name='pypebbleapi', version='0.1.0', url='https://github.com/youtux/pypebbleapi', license='MIT', author='Alessio Bogon', author_email='[email protected]', description='Pebble-api for python.', long_description=__doc__, packages=find_packages(), install_requires=['requests~=2.6', 'six~=1.9', 'Cerberus~=0.9'], classifiers=[ 'Development Status :: 3 - Alpha', 'Intended Audience :: Developers', 'License :: OSI Approved :: MIT License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Programming Language :: Python :: 2.7', 'Programming Language :: Python :: 3', 'Programming Language :: Python :: 3.3', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', 'Topic :: Software Development :: Libraries :: Python Modules', ] )
b6d5f0551a53cc9d97a8b5f634ec54cd9b85bf00
setup.py
setup.py
#!/usr/local/bin/python -u __author__ = 'Oliver Ratzesberger <https://github.com/fxstein>' __copyright__ = 'Copyright (C) 2015 Oliver Ratzesberger' __license__ = 'Apache License, Version 2.0' # Make sure we have access to SentientHome commons import os print 'Checking node.js presence:' if 0 != os.system('node -v'): print 'node.js not present on system. Exiting...' quit() print 'Installing node.js dependencies:' if 0 != os.system('npm install home'): print 'Error installing node.js home module. Exiting...' quit() if 0 != os.system('npm install iniparser'): print 'Error installing node.js iniparser module. Exiting...' quit() print 'Finished installing dependencies.'
#!/usr/local/bin/python -u __author__ = 'Oliver Ratzesberger <https://github.com/fxstein>' __copyright__ = 'Copyright (C) 2015 Oliver Ratzesberger' __license__ = 'Apache License, Version 2.0' # Make sure we have access to SentientHome commons import os print 'Checking node.js presence:' if 0 != os.system('node -v'): print 'node.js not present on system. Exiting...' quit() print 'Installing node.js dependencies:' if 0 != os.system('npm install home'): print 'Error installing node.js home module. Exiting...' quit() if 0 != os.system('npm install iniparser'): print 'Error installing node.js iniparser module. Exiting...' quit() print 'Installing Python3 dependencies' if 0 != os.system('pip3 install asyncio'): print 'Error installing python3 asyncio package. Exiting...' quit() if 0 != os.system('pip3 install aiohttp'): print 'Error installing python3 aiohttp package. Exiting...' quit() print 'Finished installing dependencies.'
Add installation of some python 3 packages
Add installation of some python 3 packages
Python
apache-2.0
fxstein/SentientHome
#!/usr/local/bin/python -u __author__ = 'Oliver Ratzesberger <https://github.com/fxstein>' __copyright__ = 'Copyright (C) 2015 Oliver Ratzesberger' __license__ = 'Apache License, Version 2.0' # Make sure we have access to SentientHome commons import os print 'Checking node.js presence:' if 0 != os.system('node -v'): print 'node.js not present on system. Exiting...' quit() print 'Installing node.js dependencies:' if 0 != os.system('npm install home'): print 'Error installing node.js home module. Exiting...' quit() if 0 != os.system('npm install iniparser'): print 'Error installing node.js iniparser module. Exiting...' quit() print 'Finished installing dependencies.' Add installation of some python 3 packages
#!/usr/local/bin/python -u __author__ = 'Oliver Ratzesberger <https://github.com/fxstein>' __copyright__ = 'Copyright (C) 2015 Oliver Ratzesberger' __license__ = 'Apache License, Version 2.0' # Make sure we have access to SentientHome commons import os print 'Checking node.js presence:' if 0 != os.system('node -v'): print 'node.js not present on system. Exiting...' quit() print 'Installing node.js dependencies:' if 0 != os.system('npm install home'): print 'Error installing node.js home module. Exiting...' quit() if 0 != os.system('npm install iniparser'): print 'Error installing node.js iniparser module. Exiting...' quit() print 'Installing Python3 dependencies' if 0 != os.system('pip3 install asyncio'): print 'Error installing python3 asyncio package. Exiting...' quit() if 0 != os.system('pip3 install aiohttp'): print 'Error installing python3 aiohttp package. Exiting...' quit() print 'Finished installing dependencies.'
<commit_before>#!/usr/local/bin/python -u __author__ = 'Oliver Ratzesberger <https://github.com/fxstein>' __copyright__ = 'Copyright (C) 2015 Oliver Ratzesberger' __license__ = 'Apache License, Version 2.0' # Make sure we have access to SentientHome commons import os print 'Checking node.js presence:' if 0 != os.system('node -v'): print 'node.js not present on system. Exiting...' quit() print 'Installing node.js dependencies:' if 0 != os.system('npm install home'): print 'Error installing node.js home module. Exiting...' quit() if 0 != os.system('npm install iniparser'): print 'Error installing node.js iniparser module. Exiting...' quit() print 'Finished installing dependencies.' <commit_msg>Add installation of some python 3 packages<commit_after>
#!/usr/local/bin/python -u __author__ = 'Oliver Ratzesberger <https://github.com/fxstein>' __copyright__ = 'Copyright (C) 2015 Oliver Ratzesberger' __license__ = 'Apache License, Version 2.0' # Make sure we have access to SentientHome commons import os print 'Checking node.js presence:' if 0 != os.system('node -v'): print 'node.js not present on system. Exiting...' quit() print 'Installing node.js dependencies:' if 0 != os.system('npm install home'): print 'Error installing node.js home module. Exiting...' quit() if 0 != os.system('npm install iniparser'): print 'Error installing node.js iniparser module. Exiting...' quit() print 'Installing Python3 dependencies' if 0 != os.system('pip3 install asyncio'): print 'Error installing python3 asyncio package. Exiting...' quit() if 0 != os.system('pip3 install aiohttp'): print 'Error installing python3 aiohttp package. Exiting...' quit() print 'Finished installing dependencies.'
#!/usr/local/bin/python -u __author__ = 'Oliver Ratzesberger <https://github.com/fxstein>' __copyright__ = 'Copyright (C) 2015 Oliver Ratzesberger' __license__ = 'Apache License, Version 2.0' # Make sure we have access to SentientHome commons import os print 'Checking node.js presence:' if 0 != os.system('node -v'): print 'node.js not present on system. Exiting...' quit() print 'Installing node.js dependencies:' if 0 != os.system('npm install home'): print 'Error installing node.js home module. Exiting...' quit() if 0 != os.system('npm install iniparser'): print 'Error installing node.js iniparser module. Exiting...' quit() print 'Finished installing dependencies.' Add installation of some python 3 packages#!/usr/local/bin/python -u __author__ = 'Oliver Ratzesberger <https://github.com/fxstein>' __copyright__ = 'Copyright (C) 2015 Oliver Ratzesberger' __license__ = 'Apache License, Version 2.0' # Make sure we have access to SentientHome commons import os print 'Checking node.js presence:' if 0 != os.system('node -v'): print 'node.js not present on system. Exiting...' quit() print 'Installing node.js dependencies:' if 0 != os.system('npm install home'): print 'Error installing node.js home module. Exiting...' quit() if 0 != os.system('npm install iniparser'): print 'Error installing node.js iniparser module. Exiting...' quit() print 'Installing Python3 dependencies' if 0 != os.system('pip3 install asyncio'): print 'Error installing python3 asyncio package. Exiting...' quit() if 0 != os.system('pip3 install aiohttp'): print 'Error installing python3 aiohttp package. Exiting...' quit() print 'Finished installing dependencies.'
<commit_before>#!/usr/local/bin/python -u __author__ = 'Oliver Ratzesberger <https://github.com/fxstein>' __copyright__ = 'Copyright (C) 2015 Oliver Ratzesberger' __license__ = 'Apache License, Version 2.0' # Make sure we have access to SentientHome commons import os print 'Checking node.js presence:' if 0 != os.system('node -v'): print 'node.js not present on system. Exiting...' quit() print 'Installing node.js dependencies:' if 0 != os.system('npm install home'): print 'Error installing node.js home module. Exiting...' quit() if 0 != os.system('npm install iniparser'): print 'Error installing node.js iniparser module. Exiting...' quit() print 'Finished installing dependencies.' <commit_msg>Add installation of some python 3 packages<commit_after>#!/usr/local/bin/python -u __author__ = 'Oliver Ratzesberger <https://github.com/fxstein>' __copyright__ = 'Copyright (C) 2015 Oliver Ratzesberger' __license__ = 'Apache License, Version 2.0' # Make sure we have access to SentientHome commons import os print 'Checking node.js presence:' if 0 != os.system('node -v'): print 'node.js not present on system. Exiting...' quit() print 'Installing node.js dependencies:' if 0 != os.system('npm install home'): print 'Error installing node.js home module. Exiting...' quit() if 0 != os.system('npm install iniparser'): print 'Error installing node.js iniparser module. Exiting...' quit() print 'Installing Python3 dependencies' if 0 != os.system('pip3 install asyncio'): print 'Error installing python3 asyncio package. Exiting...' quit() if 0 != os.system('pip3 install aiohttp'): print 'Error installing python3 aiohttp package. Exiting...' quit() print 'Finished installing dependencies.'
5a648d2125deb4e5b7e62369378d8fa5c13818e6
setup.py
setup.py
from setuptools import setup setup( name='aufmachen', version='0.1-dev', url='http://github.com/fdb/aufmachen', license='BSD', author='Frederik & Jan De Bleser', description='Turns a website\'s HTML into nice, clean objects.', packages=['aufmachen', 'aufmachen.websites'], package_data = {'aufmachen': ['*.js']}, platforms='any', classifiers=[ 'Development Status :: 4 - Beta', 'Environment :: Web Environment', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', 'Topic :: Software Development :: Libraries :: Python Modules' ] )
from setuptools import setup setup( name='aufmachen', version='0.2.1', url='http://github.com/fdb/aufmachen', license='BSD', author='Frederik & Jan De Bleser', author_email='[email protected]', description='Turns a website\'s HTML into nice, clean objects.', packages=['aufmachen', 'aufmachen.websites'], package_data = {'aufmachen': ['*.js']}, platforms='any', classifiers=[ 'Development Status :: 4 - Beta', 'Environment :: Web Environment', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', 'Topic :: Software Development :: Libraries :: Python Modules' ] )
Change version number, add author email.
Change version number, add author email.
Python
bsd-2-clause
fdb/aufmachen,fdb/aufmachen
from setuptools import setup setup( name='aufmachen', version='0.1-dev', url='http://github.com/fdb/aufmachen', license='BSD', author='Frederik & Jan De Bleser', description='Turns a website\'s HTML into nice, clean objects.', packages=['aufmachen', 'aufmachen.websites'], package_data = {'aufmachen': ['*.js']}, platforms='any', classifiers=[ 'Development Status :: 4 - Beta', 'Environment :: Web Environment', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', 'Topic :: Software Development :: Libraries :: Python Modules' ] ) Change version number, add author email.
from setuptools import setup setup( name='aufmachen', version='0.2.1', url='http://github.com/fdb/aufmachen', license='BSD', author='Frederik & Jan De Bleser', author_email='[email protected]', description='Turns a website\'s HTML into nice, clean objects.', packages=['aufmachen', 'aufmachen.websites'], package_data = {'aufmachen': ['*.js']}, platforms='any', classifiers=[ 'Development Status :: 4 - Beta', 'Environment :: Web Environment', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', 'Topic :: Software Development :: Libraries :: Python Modules' ] )
<commit_before>from setuptools import setup setup( name='aufmachen', version='0.1-dev', url='http://github.com/fdb/aufmachen', license='BSD', author='Frederik & Jan De Bleser', description='Turns a website\'s HTML into nice, clean objects.', packages=['aufmachen', 'aufmachen.websites'], package_data = {'aufmachen': ['*.js']}, platforms='any', classifiers=[ 'Development Status :: 4 - Beta', 'Environment :: Web Environment', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', 'Topic :: Software Development :: Libraries :: Python Modules' ] ) <commit_msg>Change version number, add author email.<commit_after>
from setuptools import setup setup( name='aufmachen', version='0.2.1', url='http://github.com/fdb/aufmachen', license='BSD', author='Frederik & Jan De Bleser', author_email='[email protected]', description='Turns a website\'s HTML into nice, clean objects.', packages=['aufmachen', 'aufmachen.websites'], package_data = {'aufmachen': ['*.js']}, platforms='any', classifiers=[ 'Development Status :: 4 - Beta', 'Environment :: Web Environment', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', 'Topic :: Software Development :: Libraries :: Python Modules' ] )
from setuptools import setup setup( name='aufmachen', version='0.1-dev', url='http://github.com/fdb/aufmachen', license='BSD', author='Frederik & Jan De Bleser', description='Turns a website\'s HTML into nice, clean objects.', packages=['aufmachen', 'aufmachen.websites'], package_data = {'aufmachen': ['*.js']}, platforms='any', classifiers=[ 'Development Status :: 4 - Beta', 'Environment :: Web Environment', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', 'Topic :: Software Development :: Libraries :: Python Modules' ] ) Change version number, add author email.from setuptools import setup setup( name='aufmachen', version='0.2.1', url='http://github.com/fdb/aufmachen', license='BSD', author='Frederik & Jan De Bleser', author_email='[email protected]', description='Turns a website\'s HTML into nice, clean objects.', packages=['aufmachen', 'aufmachen.websites'], package_data = {'aufmachen': ['*.js']}, platforms='any', classifiers=[ 'Development Status :: 4 - Beta', 'Environment :: Web Environment', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', 'Topic :: Software Development :: Libraries :: Python Modules' ] )
<commit_before>from setuptools import setup setup( name='aufmachen', version='0.1-dev', url='http://github.com/fdb/aufmachen', license='BSD', author='Frederik & Jan De Bleser', description='Turns a website\'s HTML into nice, clean objects.', packages=['aufmachen', 'aufmachen.websites'], package_data = {'aufmachen': ['*.js']}, platforms='any', classifiers=[ 'Development Status :: 4 - Beta', 'Environment :: Web Environment', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', 'Topic :: Software Development :: Libraries :: Python Modules' ] ) <commit_msg>Change version number, add author email.<commit_after>from setuptools import setup setup( name='aufmachen', version='0.2.1', url='http://github.com/fdb/aufmachen', license='BSD', author='Frederik & Jan De Bleser', author_email='[email protected]', description='Turns a website\'s HTML into nice, clean objects.', packages=['aufmachen', 'aufmachen.websites'], package_data = {'aufmachen': ['*.js']}, platforms='any', classifiers=[ 'Development Status :: 4 - Beta', 'Environment :: Web Environment', 'Intended Audience :: Developers', 'License :: OSI Approved :: BSD License', 'Operating System :: OS Independent', 'Programming Language :: Python', 'Topic :: Internet :: WWW/HTTP :: Dynamic Content', 'Topic :: Software Development :: Libraries :: Python Modules' ] )
2e3e2dc66add761c228e0cc685dc808bddd1952e
spicedham/backend.py
spicedham/backend.py
from config import config class BackendNotRecognizedException(Exception): """Possible backends are "sqlalchemy", "elasticsearch", and "djangoorm""""" pass if config['backend'] == 'sqlalchemy': from sqlalchemywrapper.sqlalchemywrapper import SqlAlchemyWrapper as Backend elif config['backend'] == 'elasticsearch': from elasticsearchwrapper import ElasticSearchWrapper as Backend elif config['backend'] == 'djangoorm': from djangoormwrapper import DjangoOrmWrapper as Backend else: raise BackendNotRecognizedException
from spicedham.config import config from sqlalchemywrapper import SqlAlchemyWrapper #from elasticsearchwrapper import ElasticSearchWrapper #from djangoormwrapper import DjangoOrmWrapper class BackendNotRecognizedException(Exception): """Possible backends are "sqlalchemy", "elasticsearch", and "djangoorm""""" pass if config['backend'] == 'sqlalchemy': Backend = SqlAlchemyWrapper() elif config['backend'] == 'elasticsearch': Backend = ElasticSearchWrapper() elif config['backend'] == 'djangoorm': Backend = DjangoOrmWrapper() else: raise BackendNotRecognizedException
Fix imports and duck typing
Fix imports and duck typing * Always import all backends * Only assign the right one to Backend based off the config * Fix the config import
Python
mpl-2.0
mozilla/spicedham,mozilla/spicedham
from config import config class BackendNotRecognizedException(Exception): """Possible backends are "sqlalchemy", "elasticsearch", and "djangoorm""""" pass if config['backend'] == 'sqlalchemy': from sqlalchemywrapper.sqlalchemywrapper import SqlAlchemyWrapper as Backend elif config['backend'] == 'elasticsearch': from elasticsearchwrapper import ElasticSearchWrapper as Backend elif config['backend'] == 'djangoorm': from djangoormwrapper import DjangoOrmWrapper as Backend else: raise BackendNotRecognizedException Fix imports and duck typing * Always import all backends * Only assign the right one to Backend based off the config * Fix the config import
from spicedham.config import config from sqlalchemywrapper import SqlAlchemyWrapper #from elasticsearchwrapper import ElasticSearchWrapper #from djangoormwrapper import DjangoOrmWrapper class BackendNotRecognizedException(Exception): """Possible backends are "sqlalchemy", "elasticsearch", and "djangoorm""""" pass if config['backend'] == 'sqlalchemy': Backend = SqlAlchemyWrapper() elif config['backend'] == 'elasticsearch': Backend = ElasticSearchWrapper() elif config['backend'] == 'djangoorm': Backend = DjangoOrmWrapper() else: raise BackendNotRecognizedException
<commit_before>from config import config class BackendNotRecognizedException(Exception): """Possible backends are "sqlalchemy", "elasticsearch", and "djangoorm""""" pass if config['backend'] == 'sqlalchemy': from sqlalchemywrapper.sqlalchemywrapper import SqlAlchemyWrapper as Backend elif config['backend'] == 'elasticsearch': from elasticsearchwrapper import ElasticSearchWrapper as Backend elif config['backend'] == 'djangoorm': from djangoormwrapper import DjangoOrmWrapper as Backend else: raise BackendNotRecognizedException <commit_msg>Fix imports and duck typing * Always import all backends * Only assign the right one to Backend based off the config * Fix the config import<commit_after>
from spicedham.config import config from sqlalchemywrapper import SqlAlchemyWrapper #from elasticsearchwrapper import ElasticSearchWrapper #from djangoormwrapper import DjangoOrmWrapper class BackendNotRecognizedException(Exception): """Possible backends are "sqlalchemy", "elasticsearch", and "djangoorm""""" pass if config['backend'] == 'sqlalchemy': Backend = SqlAlchemyWrapper() elif config['backend'] == 'elasticsearch': Backend = ElasticSearchWrapper() elif config['backend'] == 'djangoorm': Backend = DjangoOrmWrapper() else: raise BackendNotRecognizedException
from config import config class BackendNotRecognizedException(Exception): """Possible backends are "sqlalchemy", "elasticsearch", and "djangoorm""""" pass if config['backend'] == 'sqlalchemy': from sqlalchemywrapper.sqlalchemywrapper import SqlAlchemyWrapper as Backend elif config['backend'] == 'elasticsearch': from elasticsearchwrapper import ElasticSearchWrapper as Backend elif config['backend'] == 'djangoorm': from djangoormwrapper import DjangoOrmWrapper as Backend else: raise BackendNotRecognizedException Fix imports and duck typing * Always import all backends * Only assign the right one to Backend based off the config * Fix the config importfrom spicedham.config import config from sqlalchemywrapper import SqlAlchemyWrapper #from elasticsearchwrapper import ElasticSearchWrapper #from djangoormwrapper import DjangoOrmWrapper class BackendNotRecognizedException(Exception): """Possible backends are "sqlalchemy", "elasticsearch", and "djangoorm""""" pass if config['backend'] == 'sqlalchemy': Backend = SqlAlchemyWrapper() elif config['backend'] == 'elasticsearch': Backend = ElasticSearchWrapper() elif config['backend'] == 'djangoorm': Backend = DjangoOrmWrapper() else: raise BackendNotRecognizedException
<commit_before>from config import config class BackendNotRecognizedException(Exception): """Possible backends are "sqlalchemy", "elasticsearch", and "djangoorm""""" pass if config['backend'] == 'sqlalchemy': from sqlalchemywrapper.sqlalchemywrapper import SqlAlchemyWrapper as Backend elif config['backend'] == 'elasticsearch': from elasticsearchwrapper import ElasticSearchWrapper as Backend elif config['backend'] == 'djangoorm': from djangoormwrapper import DjangoOrmWrapper as Backend else: raise BackendNotRecognizedException <commit_msg>Fix imports and duck typing * Always import all backends * Only assign the right one to Backend based off the config * Fix the config import<commit_after>from spicedham.config import config from sqlalchemywrapper import SqlAlchemyWrapper #from elasticsearchwrapper import ElasticSearchWrapper #from djangoormwrapper import DjangoOrmWrapper class BackendNotRecognizedException(Exception): """Possible backends are "sqlalchemy", "elasticsearch", and "djangoorm""""" pass if config['backend'] == 'sqlalchemy': Backend = SqlAlchemyWrapper() elif config['backend'] == 'elasticsearch': Backend = ElasticSearchWrapper() elif config['backend'] == 'djangoorm': Backend = DjangoOrmWrapper() else: raise BackendNotRecognizedException
787fef7c74ca46b83557edaf3bb4d0189a586204
build.py
build.py
from elixir.compilers import ModelCompiler from elixir.processors import NevermoreProcessor ModelCompiler("src/", "model.rbxmx", NevermoreProcessor).compile()
from elixir.compilers import ModelCompiler ModelCompiler("src/", "model.rbxmx").compile()
Remove the use of the Nevermore processor
Remove the use of the Nevermore processor
Python
mit
VoxelDavid/echo-ridge
from elixir.compilers import ModelCompiler from elixir.processors import NevermoreProcessor ModelCompiler("src/", "model.rbxmx", NevermoreProcessor).compile() Remove the use of the Nevermore processor
from elixir.compilers import ModelCompiler ModelCompiler("src/", "model.rbxmx").compile()
<commit_before>from elixir.compilers import ModelCompiler from elixir.processors import NevermoreProcessor ModelCompiler("src/", "model.rbxmx", NevermoreProcessor).compile() <commit_msg>Remove the use of the Nevermore processor<commit_after>
from elixir.compilers import ModelCompiler ModelCompiler("src/", "model.rbxmx").compile()
from elixir.compilers import ModelCompiler from elixir.processors import NevermoreProcessor ModelCompiler("src/", "model.rbxmx", NevermoreProcessor).compile() Remove the use of the Nevermore processorfrom elixir.compilers import ModelCompiler ModelCompiler("src/", "model.rbxmx").compile()
<commit_before>from elixir.compilers import ModelCompiler from elixir.processors import NevermoreProcessor ModelCompiler("src/", "model.rbxmx", NevermoreProcessor).compile() <commit_msg>Remove the use of the Nevermore processor<commit_after>from elixir.compilers import ModelCompiler ModelCompiler("src/", "model.rbxmx").compile()
2d73c633f3d21f0b9ff5d80eebdfca9a48a478f5
babyonboard/api/tests/test_models.py
babyonboard/api/tests/test_models.py
from django.test import TestCase from ..models import Temperature class TemperatureTest(TestCase): """Test class for temperature model""" def setUp(self): Temperature.objects.create(temperature=20.5) def test_create_temperature(self): temperature = Temperature.objects.get(temperature=20.5) self.assertIsNotNone(temperature) self.assertTrue(isinstance(temperature, Temperature)) self.assertEqual(temperature.__str__(), str(temperature.temperature))
from django.test import TestCase from ..models import Temperature, HeartBeats class TemperatureTest(TestCase): """Test class for temperature model""" def setUp(self): Temperature.objects.create(temperature=20.5) def test_create_temperature(self): temperature = Temperature.objects.get(temperature=20.5) self.assertIsNotNone(temperature) self.assertTrue(isinstance(temperature, Temperature)) self.assertEqual(temperature.__str__(), str(temperature.temperature)) class HeartBeatsTest(TestCase): """Test class for heartbeats model""" def setUp(self): HeartBeats.objects.create(beats=70) def test_create_heartbeats(self): heartBeats = HeartBeats.objects.get(beats=70) self.assertIsNotNone(heartBeats) self.assertTrue(isinstance(heartBeats, HeartBeats)) self.assertEqual(heartBeats.__str__(), str(heartBeats.beats))
Implement tests for heartbeats model
Implement tests for heartbeats model
Python
mit
BabyOnBoard/BabyOnBoard-API,BabyOnBoard/BabyOnBoard-API
from django.test import TestCase from ..models import Temperature class TemperatureTest(TestCase): """Test class for temperature model""" def setUp(self): Temperature.objects.create(temperature=20.5) def test_create_temperature(self): temperature = Temperature.objects.get(temperature=20.5) self.assertIsNotNone(temperature) self.assertTrue(isinstance(temperature, Temperature)) self.assertEqual(temperature.__str__(), str(temperature.temperature)) Implement tests for heartbeats model
from django.test import TestCase from ..models import Temperature, HeartBeats class TemperatureTest(TestCase): """Test class for temperature model""" def setUp(self): Temperature.objects.create(temperature=20.5) def test_create_temperature(self): temperature = Temperature.objects.get(temperature=20.5) self.assertIsNotNone(temperature) self.assertTrue(isinstance(temperature, Temperature)) self.assertEqual(temperature.__str__(), str(temperature.temperature)) class HeartBeatsTest(TestCase): """Test class for heartbeats model""" def setUp(self): HeartBeats.objects.create(beats=70) def test_create_heartbeats(self): heartBeats = HeartBeats.objects.get(beats=70) self.assertIsNotNone(heartBeats) self.assertTrue(isinstance(heartBeats, HeartBeats)) self.assertEqual(heartBeats.__str__(), str(heartBeats.beats))
<commit_before>from django.test import TestCase from ..models import Temperature class TemperatureTest(TestCase): """Test class for temperature model""" def setUp(self): Temperature.objects.create(temperature=20.5) def test_create_temperature(self): temperature = Temperature.objects.get(temperature=20.5) self.assertIsNotNone(temperature) self.assertTrue(isinstance(temperature, Temperature)) self.assertEqual(temperature.__str__(), str(temperature.temperature)) <commit_msg>Implement tests for heartbeats model<commit_after>
from django.test import TestCase from ..models import Temperature, HeartBeats class TemperatureTest(TestCase): """Test class for temperature model""" def setUp(self): Temperature.objects.create(temperature=20.5) def test_create_temperature(self): temperature = Temperature.objects.get(temperature=20.5) self.assertIsNotNone(temperature) self.assertTrue(isinstance(temperature, Temperature)) self.assertEqual(temperature.__str__(), str(temperature.temperature)) class HeartBeatsTest(TestCase): """Test class for heartbeats model""" def setUp(self): HeartBeats.objects.create(beats=70) def test_create_heartbeats(self): heartBeats = HeartBeats.objects.get(beats=70) self.assertIsNotNone(heartBeats) self.assertTrue(isinstance(heartBeats, HeartBeats)) self.assertEqual(heartBeats.__str__(), str(heartBeats.beats))
from django.test import TestCase from ..models import Temperature class TemperatureTest(TestCase): """Test class for temperature model""" def setUp(self): Temperature.objects.create(temperature=20.5) def test_create_temperature(self): temperature = Temperature.objects.get(temperature=20.5) self.assertIsNotNone(temperature) self.assertTrue(isinstance(temperature, Temperature)) self.assertEqual(temperature.__str__(), str(temperature.temperature)) Implement tests for heartbeats modelfrom django.test import TestCase from ..models import Temperature, HeartBeats class TemperatureTest(TestCase): """Test class for temperature model""" def setUp(self): Temperature.objects.create(temperature=20.5) def test_create_temperature(self): temperature = Temperature.objects.get(temperature=20.5) self.assertIsNotNone(temperature) self.assertTrue(isinstance(temperature, Temperature)) self.assertEqual(temperature.__str__(), str(temperature.temperature)) class HeartBeatsTest(TestCase): """Test class for heartbeats model""" def setUp(self): HeartBeats.objects.create(beats=70) def test_create_heartbeats(self): heartBeats = HeartBeats.objects.get(beats=70) self.assertIsNotNone(heartBeats) self.assertTrue(isinstance(heartBeats, HeartBeats)) self.assertEqual(heartBeats.__str__(), str(heartBeats.beats))
<commit_before>from django.test import TestCase from ..models import Temperature class TemperatureTest(TestCase): """Test class for temperature model""" def setUp(self): Temperature.objects.create(temperature=20.5) def test_create_temperature(self): temperature = Temperature.objects.get(temperature=20.5) self.assertIsNotNone(temperature) self.assertTrue(isinstance(temperature, Temperature)) self.assertEqual(temperature.__str__(), str(temperature.temperature)) <commit_msg>Implement tests for heartbeats model<commit_after>from django.test import TestCase from ..models import Temperature, HeartBeats class TemperatureTest(TestCase): """Test class for temperature model""" def setUp(self): Temperature.objects.create(temperature=20.5) def test_create_temperature(self): temperature = Temperature.objects.get(temperature=20.5) self.assertIsNotNone(temperature) self.assertTrue(isinstance(temperature, Temperature)) self.assertEqual(temperature.__str__(), str(temperature.temperature)) class HeartBeatsTest(TestCase): """Test class for heartbeats model""" def setUp(self): HeartBeats.objects.create(beats=70) def test_create_heartbeats(self): heartBeats = HeartBeats.objects.get(beats=70) self.assertIsNotNone(heartBeats) self.assertTrue(isinstance(heartBeats, HeartBeats)) self.assertEqual(heartBeats.__str__(), str(heartBeats.beats))
4a0edb289a3a8a3195a339a1c89a444f414b8645
tm/tm.py
tm/tm.py
#!/usr/bin/python # -*- coding: utf-8 -*- import json import os import sys import argparse import tmux_wrapper as tmux __version__ = 1.0 __description__ = "A tmux wrapper featuring shortcuts and session presets." def load_session_presets(): try: file_path = os.environ["TM_SESSIONS"] except KeyError: return None try: with open(file_path) as f: config = json.load(f) except IOError: print("Invalid TM_SESSIONS environmental variable: cannot open file {}".format(file_path)) def main(argv): parser = argparse.ArgumentParser(description=__description__) parser.add_argument("session", metavar="session", type=str, nargs="?", help="the name of the tmux session to start or attach") parser.add_argument("-l", "--list", action="store_true", help="list all open sessions and session presets") parser.add_argument("-k", "--kill", metavar="session", action="store", help="kill a session") args = parser.parse_args() if len(argv) == 0: parser.print_help() if args.kill: try: tmux.kill(args.kill) except tmux.ServerConnectionError, e: print(e.description) elif args.list: print tmux.list() elif args.session: tmux.create_or_attach(args.session) if __name__ == "__main__": main(sys.argv[1:])
#!/usr/bin/python # -*- coding: utf-8 -*- import json import os import sys import argparse import tmux_wrapper as tmux __version__ = 1.0 __description__ = "A tmux wrapper featuring shortcuts and session presets." def load_session_presets(): try: file_path = os.environ["TM_SESSIONS"] except KeyError: return None try: with open(file_path) as f: config = json.load(f) except IOError: print("Invalid TM_SESSIONS environmental variable: cannot open file {}".format(file_path)) def main(argv): parser = argparse.ArgumentParser(description=__description__) parser.add_argument("session", metavar="session", type=str, nargs="?", help="the name of the tmux session to start or attach") parser.add_argument("-l", "--list", action="store_true", help="list all open sessions and session presets") parser.add_argument("-k", "--kill", metavar="session", action="store", help="kill a session") args = parser.parse_args() if len(argv) == 0: parser.print_help() if args.kill: try: tmux.kill(args.kill) except (tmux.ServerConnectionError, tmux.SessionDoesNotExist), e: print(e.description) elif args.list: try: print tmux.list() except tmux.ServerConnectionError, e: print(e.description) elif args.session: tmux.create_or_attach(args.session) if __name__ == "__main__": main(sys.argv[1:])
Check for all exceptions to main method
Check for all exceptions to main method
Python
mit
ethanal/tm
#!/usr/bin/python # -*- coding: utf-8 -*- import json import os import sys import argparse import tmux_wrapper as tmux __version__ = 1.0 __description__ = "A tmux wrapper featuring shortcuts and session presets." def load_session_presets(): try: file_path = os.environ["TM_SESSIONS"] except KeyError: return None try: with open(file_path) as f: config = json.load(f) except IOError: print("Invalid TM_SESSIONS environmental variable: cannot open file {}".format(file_path)) def main(argv): parser = argparse.ArgumentParser(description=__description__) parser.add_argument("session", metavar="session", type=str, nargs="?", help="the name of the tmux session to start or attach") parser.add_argument("-l", "--list", action="store_true", help="list all open sessions and session presets") parser.add_argument("-k", "--kill", metavar="session", action="store", help="kill a session") args = parser.parse_args() if len(argv) == 0: parser.print_help() if args.kill: try: tmux.kill(args.kill) except tmux.ServerConnectionError, e: print(e.description) elif args.list: print tmux.list() elif args.session: tmux.create_or_attach(args.session) if __name__ == "__main__": main(sys.argv[1:])Check for all exceptions to main method
#!/usr/bin/python # -*- coding: utf-8 -*- import json import os import sys import argparse import tmux_wrapper as tmux __version__ = 1.0 __description__ = "A tmux wrapper featuring shortcuts and session presets." def load_session_presets(): try: file_path = os.environ["TM_SESSIONS"] except KeyError: return None try: with open(file_path) as f: config = json.load(f) except IOError: print("Invalid TM_SESSIONS environmental variable: cannot open file {}".format(file_path)) def main(argv): parser = argparse.ArgumentParser(description=__description__) parser.add_argument("session", metavar="session", type=str, nargs="?", help="the name of the tmux session to start or attach") parser.add_argument("-l", "--list", action="store_true", help="list all open sessions and session presets") parser.add_argument("-k", "--kill", metavar="session", action="store", help="kill a session") args = parser.parse_args() if len(argv) == 0: parser.print_help() if args.kill: try: tmux.kill(args.kill) except (tmux.ServerConnectionError, tmux.SessionDoesNotExist), e: print(e.description) elif args.list: try: print tmux.list() except tmux.ServerConnectionError, e: print(e.description) elif args.session: tmux.create_or_attach(args.session) if __name__ == "__main__": main(sys.argv[1:])
<commit_before>#!/usr/bin/python # -*- coding: utf-8 -*- import json import os import sys import argparse import tmux_wrapper as tmux __version__ = 1.0 __description__ = "A tmux wrapper featuring shortcuts and session presets." def load_session_presets(): try: file_path = os.environ["TM_SESSIONS"] except KeyError: return None try: with open(file_path) as f: config = json.load(f) except IOError: print("Invalid TM_SESSIONS environmental variable: cannot open file {}".format(file_path)) def main(argv): parser = argparse.ArgumentParser(description=__description__) parser.add_argument("session", metavar="session", type=str, nargs="?", help="the name of the tmux session to start or attach") parser.add_argument("-l", "--list", action="store_true", help="list all open sessions and session presets") parser.add_argument("-k", "--kill", metavar="session", action="store", help="kill a session") args = parser.parse_args() if len(argv) == 0: parser.print_help() if args.kill: try: tmux.kill(args.kill) except tmux.ServerConnectionError, e: print(e.description) elif args.list: print tmux.list() elif args.session: tmux.create_or_attach(args.session) if __name__ == "__main__": main(sys.argv[1:])<commit_msg>Check for all exceptions to main method<commit_after>
#!/usr/bin/python # -*- coding: utf-8 -*- import json import os import sys import argparse import tmux_wrapper as tmux __version__ = 1.0 __description__ = "A tmux wrapper featuring shortcuts and session presets." def load_session_presets(): try: file_path = os.environ["TM_SESSIONS"] except KeyError: return None try: with open(file_path) as f: config = json.load(f) except IOError: print("Invalid TM_SESSIONS environmental variable: cannot open file {}".format(file_path)) def main(argv): parser = argparse.ArgumentParser(description=__description__) parser.add_argument("session", metavar="session", type=str, nargs="?", help="the name of the tmux session to start or attach") parser.add_argument("-l", "--list", action="store_true", help="list all open sessions and session presets") parser.add_argument("-k", "--kill", metavar="session", action="store", help="kill a session") args = parser.parse_args() if len(argv) == 0: parser.print_help() if args.kill: try: tmux.kill(args.kill) except (tmux.ServerConnectionError, tmux.SessionDoesNotExist), e: print(e.description) elif args.list: try: print tmux.list() except tmux.ServerConnectionError, e: print(e.description) elif args.session: tmux.create_or_attach(args.session) if __name__ == "__main__": main(sys.argv[1:])
#!/usr/bin/python # -*- coding: utf-8 -*- import json import os import sys import argparse import tmux_wrapper as tmux __version__ = 1.0 __description__ = "A tmux wrapper featuring shortcuts and session presets." def load_session_presets(): try: file_path = os.environ["TM_SESSIONS"] except KeyError: return None try: with open(file_path) as f: config = json.load(f) except IOError: print("Invalid TM_SESSIONS environmental variable: cannot open file {}".format(file_path)) def main(argv): parser = argparse.ArgumentParser(description=__description__) parser.add_argument("session", metavar="session", type=str, nargs="?", help="the name of the tmux session to start or attach") parser.add_argument("-l", "--list", action="store_true", help="list all open sessions and session presets") parser.add_argument("-k", "--kill", metavar="session", action="store", help="kill a session") args = parser.parse_args() if len(argv) == 0: parser.print_help() if args.kill: try: tmux.kill(args.kill) except tmux.ServerConnectionError, e: print(e.description) elif args.list: print tmux.list() elif args.session: tmux.create_or_attach(args.session) if __name__ == "__main__": main(sys.argv[1:])Check for all exceptions to main method#!/usr/bin/python # -*- coding: utf-8 -*- import json import os import sys import argparse import tmux_wrapper as tmux __version__ = 1.0 __description__ = "A tmux wrapper featuring shortcuts and session presets." def load_session_presets(): try: file_path = os.environ["TM_SESSIONS"] except KeyError: return None try: with open(file_path) as f: config = json.load(f) except IOError: print("Invalid TM_SESSIONS environmental variable: cannot open file {}".format(file_path)) def main(argv): parser = argparse.ArgumentParser(description=__description__) parser.add_argument("session", metavar="session", type=str, nargs="?", help="the name of the tmux session to start or attach") parser.add_argument("-l", "--list", action="store_true", help="list all open sessions and session presets") parser.add_argument("-k", "--kill", metavar="session", action="store", help="kill a session") args = parser.parse_args() if len(argv) == 0: parser.print_help() if args.kill: try: tmux.kill(args.kill) except (tmux.ServerConnectionError, tmux.SessionDoesNotExist), e: print(e.description) elif args.list: try: print tmux.list() except tmux.ServerConnectionError, e: print(e.description) elif args.session: tmux.create_or_attach(args.session) if __name__ == "__main__": main(sys.argv[1:])
<commit_before>#!/usr/bin/python # -*- coding: utf-8 -*- import json import os import sys import argparse import tmux_wrapper as tmux __version__ = 1.0 __description__ = "A tmux wrapper featuring shortcuts and session presets." def load_session_presets(): try: file_path = os.environ["TM_SESSIONS"] except KeyError: return None try: with open(file_path) as f: config = json.load(f) except IOError: print("Invalid TM_SESSIONS environmental variable: cannot open file {}".format(file_path)) def main(argv): parser = argparse.ArgumentParser(description=__description__) parser.add_argument("session", metavar="session", type=str, nargs="?", help="the name of the tmux session to start or attach") parser.add_argument("-l", "--list", action="store_true", help="list all open sessions and session presets") parser.add_argument("-k", "--kill", metavar="session", action="store", help="kill a session") args = parser.parse_args() if len(argv) == 0: parser.print_help() if args.kill: try: tmux.kill(args.kill) except tmux.ServerConnectionError, e: print(e.description) elif args.list: print tmux.list() elif args.session: tmux.create_or_attach(args.session) if __name__ == "__main__": main(sys.argv[1:])<commit_msg>Check for all exceptions to main method<commit_after>#!/usr/bin/python # -*- coding: utf-8 -*- import json import os import sys import argparse import tmux_wrapper as tmux __version__ = 1.0 __description__ = "A tmux wrapper featuring shortcuts and session presets." def load_session_presets(): try: file_path = os.environ["TM_SESSIONS"] except KeyError: return None try: with open(file_path) as f: config = json.load(f) except IOError: print("Invalid TM_SESSIONS environmental variable: cannot open file {}".format(file_path)) def main(argv): parser = argparse.ArgumentParser(description=__description__) parser.add_argument("session", metavar="session", type=str, nargs="?", help="the name of the tmux session to start or attach") parser.add_argument("-l", "--list", action="store_true", help="list all open sessions and session presets") parser.add_argument("-k", "--kill", metavar="session", action="store", help="kill a session") args = parser.parse_args() if len(argv) == 0: parser.print_help() if args.kill: try: tmux.kill(args.kill) except (tmux.ServerConnectionError, tmux.SessionDoesNotExist), e: print(e.description) elif args.list: try: print tmux.list() except tmux.ServerConnectionError, e: print(e.description) elif args.session: tmux.create_or_attach(args.session) if __name__ == "__main__": main(sys.argv[1:])
0eab4f3c15c8167bcc1270249921269dc20dc506
s3sync/__init__.py
s3sync/__init__.py
VERSION = (0, 1) def get_version(): version = '%s.%s' % (VERSION[0], VERSION[1]) if VERSION[2]: version = '%s.%s' % (version, VERSION[2]) return version
VERSION = (0, 1) def get_version(): version = '%s.%s' % (VERSION[0], VERSION[1]) if len(VERSION) > 2: version = '%s.%s' % (version, VERSION[2]) return version
Fix get_version() to avoid KeyError
Fix get_version() to avoid KeyError
Python
bsd-3-clause
mntan/django-s3sync,pcraciunoiu/django-s3sync
VERSION = (0, 1) def get_version(): version = '%s.%s' % (VERSION[0], VERSION[1]) if VERSION[2]: version = '%s.%s' % (version, VERSION[2]) return version Fix get_version() to avoid KeyError
VERSION = (0, 1) def get_version(): version = '%s.%s' % (VERSION[0], VERSION[1]) if len(VERSION) > 2: version = '%s.%s' % (version, VERSION[2]) return version
<commit_before>VERSION = (0, 1) def get_version(): version = '%s.%s' % (VERSION[0], VERSION[1]) if VERSION[2]: version = '%s.%s' % (version, VERSION[2]) return version <commit_msg>Fix get_version() to avoid KeyError<commit_after>
VERSION = (0, 1) def get_version(): version = '%s.%s' % (VERSION[0], VERSION[1]) if len(VERSION) > 2: version = '%s.%s' % (version, VERSION[2]) return version
VERSION = (0, 1) def get_version(): version = '%s.%s' % (VERSION[0], VERSION[1]) if VERSION[2]: version = '%s.%s' % (version, VERSION[2]) return version Fix get_version() to avoid KeyErrorVERSION = (0, 1) def get_version(): version = '%s.%s' % (VERSION[0], VERSION[1]) if len(VERSION) > 2: version = '%s.%s' % (version, VERSION[2]) return version
<commit_before>VERSION = (0, 1) def get_version(): version = '%s.%s' % (VERSION[0], VERSION[1]) if VERSION[2]: version = '%s.%s' % (version, VERSION[2]) return version <commit_msg>Fix get_version() to avoid KeyError<commit_after>VERSION = (0, 1) def get_version(): version = '%s.%s' % (VERSION[0], VERSION[1]) if len(VERSION) > 2: version = '%s.%s' % (version, VERSION[2]) return version
8b9733eafba371350bff7f58512eac8bf42cc782
onitu/utils.py
onitu/utils.py
import time import functools import redis class Redis(redis.Redis): class RedisSession(object): def __init__(self, redis, prefix=''): self.prefix = prefix self.redis = redis def start(self, prefix): self.prefix = prefix + ':' if prefix else '' def __getattr__(self, name): try: return self._wrap(getattr(self.redis, name)) except AttributeError: return super(Redis.RedisSession, self).__getattr__(name) def _wrap(self, method): @functools.wraps(method) def wrapper(*args, **kwargs): if len(args) and isinstance(args[0], basestring): args = (self.prefix + args[0],) + args[1:] return method(*args, **kwargs) return wrapper def __init__(self, *args, **kwargs): super(Redis, self).__init__(*args, **kwargs) self.session = self.RedisSession(self) def connect_to_redis(*args, **kwargs): client = Redis( *args, unix_socket_path='redis/redis.sock', decode_responses=True, **kwargs ) while True: try: assert client.ping() except (redis.exceptions.ConnectionError, AssertionError): time.sleep(0.05) else: client.session.start(client.get('session')) return client
import time import functools import redis class Redis(redis.Redis): class RedisSession(object): def __init__(self, redis, prefix=''): self.prefix = prefix self.redis = redis def start(self, prefix): self.prefix = prefix + ':' if prefix else '' def __getattr__(self, name): try: return self._wrap(getattr(self.redis, name)) except AttributeError: return super(Redis.RedisSession, self).__getattr__(name) def _wrap(self, method): @functools.wraps(method) def wrapper(*args, **kwargs): if len(args) and isinstance(args[0], str): args = (self.prefix + args[0],) + args[1:] return method(*args, **kwargs) return wrapper def __init__(self, *args, **kwargs): super(Redis, self).__init__(*args, **kwargs) self.session = self.RedisSession(self) def connect_to_redis(*args, **kwargs): client = Redis( *args, unix_socket_path='redis/redis.sock', decode_responses=True, **kwargs ) while True: try: assert client.ping() except (redis.exceptions.ConnectionError, AssertionError): time.sleep(0.05) else: client.session.start(client.get('session')) return client
Replace 'basestring' by 'str' for Python 3 compatibility
Replace 'basestring' by 'str' for Python 3 compatibility
Python
mit
onitu/onitu,onitu/onitu,onitu/onitu
import time import functools import redis class Redis(redis.Redis): class RedisSession(object): def __init__(self, redis, prefix=''): self.prefix = prefix self.redis = redis def start(self, prefix): self.prefix = prefix + ':' if prefix else '' def __getattr__(self, name): try: return self._wrap(getattr(self.redis, name)) except AttributeError: return super(Redis.RedisSession, self).__getattr__(name) def _wrap(self, method): @functools.wraps(method) def wrapper(*args, **kwargs): if len(args) and isinstance(args[0], basestring): args = (self.prefix + args[0],) + args[1:] return method(*args, **kwargs) return wrapper def __init__(self, *args, **kwargs): super(Redis, self).__init__(*args, **kwargs) self.session = self.RedisSession(self) def connect_to_redis(*args, **kwargs): client = Redis( *args, unix_socket_path='redis/redis.sock', decode_responses=True, **kwargs ) while True: try: assert client.ping() except (redis.exceptions.ConnectionError, AssertionError): time.sleep(0.05) else: client.session.start(client.get('session')) return client Replace 'basestring' by 'str' for Python 3 compatibility
import time import functools import redis class Redis(redis.Redis): class RedisSession(object): def __init__(self, redis, prefix=''): self.prefix = prefix self.redis = redis def start(self, prefix): self.prefix = prefix + ':' if prefix else '' def __getattr__(self, name): try: return self._wrap(getattr(self.redis, name)) except AttributeError: return super(Redis.RedisSession, self).__getattr__(name) def _wrap(self, method): @functools.wraps(method) def wrapper(*args, **kwargs): if len(args) and isinstance(args[0], str): args = (self.prefix + args[0],) + args[1:] return method(*args, **kwargs) return wrapper def __init__(self, *args, **kwargs): super(Redis, self).__init__(*args, **kwargs) self.session = self.RedisSession(self) def connect_to_redis(*args, **kwargs): client = Redis( *args, unix_socket_path='redis/redis.sock', decode_responses=True, **kwargs ) while True: try: assert client.ping() except (redis.exceptions.ConnectionError, AssertionError): time.sleep(0.05) else: client.session.start(client.get('session')) return client
<commit_before>import time import functools import redis class Redis(redis.Redis): class RedisSession(object): def __init__(self, redis, prefix=''): self.prefix = prefix self.redis = redis def start(self, prefix): self.prefix = prefix + ':' if prefix else '' def __getattr__(self, name): try: return self._wrap(getattr(self.redis, name)) except AttributeError: return super(Redis.RedisSession, self).__getattr__(name) def _wrap(self, method): @functools.wraps(method) def wrapper(*args, **kwargs): if len(args) and isinstance(args[0], basestring): args = (self.prefix + args[0],) + args[1:] return method(*args, **kwargs) return wrapper def __init__(self, *args, **kwargs): super(Redis, self).__init__(*args, **kwargs) self.session = self.RedisSession(self) def connect_to_redis(*args, **kwargs): client = Redis( *args, unix_socket_path='redis/redis.sock', decode_responses=True, **kwargs ) while True: try: assert client.ping() except (redis.exceptions.ConnectionError, AssertionError): time.sleep(0.05) else: client.session.start(client.get('session')) return client <commit_msg>Replace 'basestring' by 'str' for Python 3 compatibility<commit_after>
import time import functools import redis class Redis(redis.Redis): class RedisSession(object): def __init__(self, redis, prefix=''): self.prefix = prefix self.redis = redis def start(self, prefix): self.prefix = prefix + ':' if prefix else '' def __getattr__(self, name): try: return self._wrap(getattr(self.redis, name)) except AttributeError: return super(Redis.RedisSession, self).__getattr__(name) def _wrap(self, method): @functools.wraps(method) def wrapper(*args, **kwargs): if len(args) and isinstance(args[0], str): args = (self.prefix + args[0],) + args[1:] return method(*args, **kwargs) return wrapper def __init__(self, *args, **kwargs): super(Redis, self).__init__(*args, **kwargs) self.session = self.RedisSession(self) def connect_to_redis(*args, **kwargs): client = Redis( *args, unix_socket_path='redis/redis.sock', decode_responses=True, **kwargs ) while True: try: assert client.ping() except (redis.exceptions.ConnectionError, AssertionError): time.sleep(0.05) else: client.session.start(client.get('session')) return client
import time import functools import redis class Redis(redis.Redis): class RedisSession(object): def __init__(self, redis, prefix=''): self.prefix = prefix self.redis = redis def start(self, prefix): self.prefix = prefix + ':' if prefix else '' def __getattr__(self, name): try: return self._wrap(getattr(self.redis, name)) except AttributeError: return super(Redis.RedisSession, self).__getattr__(name) def _wrap(self, method): @functools.wraps(method) def wrapper(*args, **kwargs): if len(args) and isinstance(args[0], basestring): args = (self.prefix + args[0],) + args[1:] return method(*args, **kwargs) return wrapper def __init__(self, *args, **kwargs): super(Redis, self).__init__(*args, **kwargs) self.session = self.RedisSession(self) def connect_to_redis(*args, **kwargs): client = Redis( *args, unix_socket_path='redis/redis.sock', decode_responses=True, **kwargs ) while True: try: assert client.ping() except (redis.exceptions.ConnectionError, AssertionError): time.sleep(0.05) else: client.session.start(client.get('session')) return client Replace 'basestring' by 'str' for Python 3 compatibilityimport time import functools import redis class Redis(redis.Redis): class RedisSession(object): def __init__(self, redis, prefix=''): self.prefix = prefix self.redis = redis def start(self, prefix): self.prefix = prefix + ':' if prefix else '' def __getattr__(self, name): try: return self._wrap(getattr(self.redis, name)) except AttributeError: return super(Redis.RedisSession, self).__getattr__(name) def _wrap(self, method): @functools.wraps(method) def wrapper(*args, **kwargs): if len(args) and isinstance(args[0], str): args = (self.prefix + args[0],) + args[1:] return method(*args, **kwargs) return wrapper def __init__(self, *args, **kwargs): super(Redis, self).__init__(*args, **kwargs) self.session = self.RedisSession(self) def connect_to_redis(*args, **kwargs): client = Redis( *args, unix_socket_path='redis/redis.sock', decode_responses=True, **kwargs ) while True: try: assert client.ping() except (redis.exceptions.ConnectionError, AssertionError): time.sleep(0.05) else: client.session.start(client.get('session')) return client
<commit_before>import time import functools import redis class Redis(redis.Redis): class RedisSession(object): def __init__(self, redis, prefix=''): self.prefix = prefix self.redis = redis def start(self, prefix): self.prefix = prefix + ':' if prefix else '' def __getattr__(self, name): try: return self._wrap(getattr(self.redis, name)) except AttributeError: return super(Redis.RedisSession, self).__getattr__(name) def _wrap(self, method): @functools.wraps(method) def wrapper(*args, **kwargs): if len(args) and isinstance(args[0], basestring): args = (self.prefix + args[0],) + args[1:] return method(*args, **kwargs) return wrapper def __init__(self, *args, **kwargs): super(Redis, self).__init__(*args, **kwargs) self.session = self.RedisSession(self) def connect_to_redis(*args, **kwargs): client = Redis( *args, unix_socket_path='redis/redis.sock', decode_responses=True, **kwargs ) while True: try: assert client.ping() except (redis.exceptions.ConnectionError, AssertionError): time.sleep(0.05) else: client.session.start(client.get('session')) return client <commit_msg>Replace 'basestring' by 'str' for Python 3 compatibility<commit_after>import time import functools import redis class Redis(redis.Redis): class RedisSession(object): def __init__(self, redis, prefix=''): self.prefix = prefix self.redis = redis def start(self, prefix): self.prefix = prefix + ':' if prefix else '' def __getattr__(self, name): try: return self._wrap(getattr(self.redis, name)) except AttributeError: return super(Redis.RedisSession, self).__getattr__(name) def _wrap(self, method): @functools.wraps(method) def wrapper(*args, **kwargs): if len(args) and isinstance(args[0], str): args = (self.prefix + args[0],) + args[1:] return method(*args, **kwargs) return wrapper def __init__(self, *args, **kwargs): super(Redis, self).__init__(*args, **kwargs) self.session = self.RedisSession(self) def connect_to_redis(*args, **kwargs): client = Redis( *args, unix_socket_path='redis/redis.sock', decode_responses=True, **kwargs ) while True: try: assert client.ping() except (redis.exceptions.ConnectionError, AssertionError): time.sleep(0.05) else: client.session.start(client.get('session')) return client
21e76ae7d9e7679007d90e842e28df46a8c0fc97
itorch-runner.py
itorch-runner.py
# coding: utf-8 import sys, getopt import os import json import datetime from subprocess import call current_date = str(datetime.datetime.now()).replace(' ', '!') output_file_name = './tmp_itorch_exec-'+current_date+'.lua' if __name__ == "__main__": if len(sys.argv) > 0: input_file = open(sys.argv[1], 'r') with input_file as json_file: json_data = json.load(json_file) input_file.close() sources = [] for item in json_data['cells']: if item['cell_type'] == 'code': sources = sources + item['source'] output_file = open(output_file_name, 'w') output_file.writelines(sources) output_file.close() call(["th", output_file_name]) os.remove(output_file_name)
# coding: utf-8 import sys, getopt import os import json import datetime from subprocess import call current_date = str(datetime.datetime.now()).replace(' ', '!') output_file_name = './tmp_itorch_exec-'+current_date+'.lua' if __name__ == "__main__": if len(sys.argv) > 0: input_file = open(sys.argv[1], 'r') with input_file as json_file: json_data = json.load(json_file) input_file.close() sources = [] for item in json_data['cells']: if item['cell_type'] == 'code' and len(item['source']) > 0: item['source'][-1] = item['source'][-1]+'\n' sources = sources + item['source'] output_file = open(output_file_name, 'w') output_file.writelines(sources) output_file.close() call(["th", output_file_name]) os.remove(output_file_name)
Fix missing new line symbol for last line in notebook cell
Fix missing new line symbol for last line in notebook cell
Python
mit
AlexMili/itorch-runner
# coding: utf-8 import sys, getopt import os import json import datetime from subprocess import call current_date = str(datetime.datetime.now()).replace(' ', '!') output_file_name = './tmp_itorch_exec-'+current_date+'.lua' if __name__ == "__main__": if len(sys.argv) > 0: input_file = open(sys.argv[1], 'r') with input_file as json_file: json_data = json.load(json_file) input_file.close() sources = [] for item in json_data['cells']: if item['cell_type'] == 'code': sources = sources + item['source'] output_file = open(output_file_name, 'w') output_file.writelines(sources) output_file.close() call(["th", output_file_name]) os.remove(output_file_name) Fix missing new line symbol for last line in notebook cell
# coding: utf-8 import sys, getopt import os import json import datetime from subprocess import call current_date = str(datetime.datetime.now()).replace(' ', '!') output_file_name = './tmp_itorch_exec-'+current_date+'.lua' if __name__ == "__main__": if len(sys.argv) > 0: input_file = open(sys.argv[1], 'r') with input_file as json_file: json_data = json.load(json_file) input_file.close() sources = [] for item in json_data['cells']: if item['cell_type'] == 'code' and len(item['source']) > 0: item['source'][-1] = item['source'][-1]+'\n' sources = sources + item['source'] output_file = open(output_file_name, 'w') output_file.writelines(sources) output_file.close() call(["th", output_file_name]) os.remove(output_file_name)
<commit_before># coding: utf-8 import sys, getopt import os import json import datetime from subprocess import call current_date = str(datetime.datetime.now()).replace(' ', '!') output_file_name = './tmp_itorch_exec-'+current_date+'.lua' if __name__ == "__main__": if len(sys.argv) > 0: input_file = open(sys.argv[1], 'r') with input_file as json_file: json_data = json.load(json_file) input_file.close() sources = [] for item in json_data['cells']: if item['cell_type'] == 'code': sources = sources + item['source'] output_file = open(output_file_name, 'w') output_file.writelines(sources) output_file.close() call(["th", output_file_name]) os.remove(output_file_name) <commit_msg>Fix missing new line symbol for last line in notebook cell<commit_after>
# coding: utf-8 import sys, getopt import os import json import datetime from subprocess import call current_date = str(datetime.datetime.now()).replace(' ', '!') output_file_name = './tmp_itorch_exec-'+current_date+'.lua' if __name__ == "__main__": if len(sys.argv) > 0: input_file = open(sys.argv[1], 'r') with input_file as json_file: json_data = json.load(json_file) input_file.close() sources = [] for item in json_data['cells']: if item['cell_type'] == 'code' and len(item['source']) > 0: item['source'][-1] = item['source'][-1]+'\n' sources = sources + item['source'] output_file = open(output_file_name, 'w') output_file.writelines(sources) output_file.close() call(["th", output_file_name]) os.remove(output_file_name)
# coding: utf-8 import sys, getopt import os import json import datetime from subprocess import call current_date = str(datetime.datetime.now()).replace(' ', '!') output_file_name = './tmp_itorch_exec-'+current_date+'.lua' if __name__ == "__main__": if len(sys.argv) > 0: input_file = open(sys.argv[1], 'r') with input_file as json_file: json_data = json.load(json_file) input_file.close() sources = [] for item in json_data['cells']: if item['cell_type'] == 'code': sources = sources + item['source'] output_file = open(output_file_name, 'w') output_file.writelines(sources) output_file.close() call(["th", output_file_name]) os.remove(output_file_name) Fix missing new line symbol for last line in notebook cell# coding: utf-8 import sys, getopt import os import json import datetime from subprocess import call current_date = str(datetime.datetime.now()).replace(' ', '!') output_file_name = './tmp_itorch_exec-'+current_date+'.lua' if __name__ == "__main__": if len(sys.argv) > 0: input_file = open(sys.argv[1], 'r') with input_file as json_file: json_data = json.load(json_file) input_file.close() sources = [] for item in json_data['cells']: if item['cell_type'] == 'code' and len(item['source']) > 0: item['source'][-1] = item['source'][-1]+'\n' sources = sources + item['source'] output_file = open(output_file_name, 'w') output_file.writelines(sources) output_file.close() call(["th", output_file_name]) os.remove(output_file_name)
<commit_before># coding: utf-8 import sys, getopt import os import json import datetime from subprocess import call current_date = str(datetime.datetime.now()).replace(' ', '!') output_file_name = './tmp_itorch_exec-'+current_date+'.lua' if __name__ == "__main__": if len(sys.argv) > 0: input_file = open(sys.argv[1], 'r') with input_file as json_file: json_data = json.load(json_file) input_file.close() sources = [] for item in json_data['cells']: if item['cell_type'] == 'code': sources = sources + item['source'] output_file = open(output_file_name, 'w') output_file.writelines(sources) output_file.close() call(["th", output_file_name]) os.remove(output_file_name) <commit_msg>Fix missing new line symbol for last line in notebook cell<commit_after># coding: utf-8 import sys, getopt import os import json import datetime from subprocess import call current_date = str(datetime.datetime.now()).replace(' ', '!') output_file_name = './tmp_itorch_exec-'+current_date+'.lua' if __name__ == "__main__": if len(sys.argv) > 0: input_file = open(sys.argv[1], 'r') with input_file as json_file: json_data = json.load(json_file) input_file.close() sources = [] for item in json_data['cells']: if item['cell_type'] == 'code' and len(item['source']) > 0: item['source'][-1] = item['source'][-1]+'\n' sources = sources + item['source'] output_file = open(output_file_name, 'w') output_file.writelines(sources) output_file.close() call(["th", output_file_name]) os.remove(output_file_name)
08c864a914b7996115f6b265cddb3c96c40e4fb5
global_functions.py
global_functions.py
import random import hashlib def get_random_id(): # generate a random unique integer random_id = random.randrange(1, 100000000) return random_id def get_attributes_from_class(instance_of_class): members = [attr for attr in dir(instance_of_class) if not callable(getattr(instance_of_class, attr)) and not attr.startswith("__")] attributes_dict = dict() for member in members: attributes_dict[member] = getattr(instance_of_class, member) return attributes_dict def sha1_hash(value): # convert string to bytes value = str.encode(value) # calculate a SHA1 hash hash_object = hashlib.sha1(value) hashed_value = hash_object.hexdigest() return hashed_value
import random import hashlib def get_random_id(): """generates a random integer value between 1 and 100000000 :return (int): randomly generated integer """ # generate a random unique integer random_id = random.randrange(1, 100000000) return random_id def get_attributes_from_class(instance_of_class): """Get attributes from a class objects and returns a dictionary containing the attribute name as (key) and the attribute value as (value) :arg instance_of_class: An object :return (dict): Attribute name as (key) and the attribute value as (value) """ # get a list of member attributes of class members = [attr for attr in dir(instance_of_class) if not callable(getattr(instance_of_class, attr)) and not attr.startswith("__")] # loop through members array and add the member value to the attributes dictionary attributes_dict = dict() for member in members: attributes_dict[member] = getattr(instance_of_class, member) return attributes_dict def sha1_hash(value): """Calculates the SHA1 has of a string :arg: value (str): String to be hashed :return (str): SHA1 hash """ # convert string to bytes value = str.encode(value) # calculate a SHA1 hash hash_object = hashlib.sha1(value) hashed_value = hash_object.hexdigest() return hashed_value
Add descriptive docstring comments global functions
[UPDATE] Add descriptive docstring comments global functions
Python
mit
EinsteinCarrey/Shoppinglist,EinsteinCarrey/Shoppinglist,EinsteinCarrey/Shoppinglist
import random import hashlib def get_random_id(): # generate a random unique integer random_id = random.randrange(1, 100000000) return random_id def get_attributes_from_class(instance_of_class): members = [attr for attr in dir(instance_of_class) if not callable(getattr(instance_of_class, attr)) and not attr.startswith("__")] attributes_dict = dict() for member in members: attributes_dict[member] = getattr(instance_of_class, member) return attributes_dict def sha1_hash(value): # convert string to bytes value = str.encode(value) # calculate a SHA1 hash hash_object = hashlib.sha1(value) hashed_value = hash_object.hexdigest() return hashed_value [UPDATE] Add descriptive docstring comments global functions
import random import hashlib def get_random_id(): """generates a random integer value between 1 and 100000000 :return (int): randomly generated integer """ # generate a random unique integer random_id = random.randrange(1, 100000000) return random_id def get_attributes_from_class(instance_of_class): """Get attributes from a class objects and returns a dictionary containing the attribute name as (key) and the attribute value as (value) :arg instance_of_class: An object :return (dict): Attribute name as (key) and the attribute value as (value) """ # get a list of member attributes of class members = [attr for attr in dir(instance_of_class) if not callable(getattr(instance_of_class, attr)) and not attr.startswith("__")] # loop through members array and add the member value to the attributes dictionary attributes_dict = dict() for member in members: attributes_dict[member] = getattr(instance_of_class, member) return attributes_dict def sha1_hash(value): """Calculates the SHA1 has of a string :arg: value (str): String to be hashed :return (str): SHA1 hash """ # convert string to bytes value = str.encode(value) # calculate a SHA1 hash hash_object = hashlib.sha1(value) hashed_value = hash_object.hexdigest() return hashed_value
<commit_before>import random import hashlib def get_random_id(): # generate a random unique integer random_id = random.randrange(1, 100000000) return random_id def get_attributes_from_class(instance_of_class): members = [attr for attr in dir(instance_of_class) if not callable(getattr(instance_of_class, attr)) and not attr.startswith("__")] attributes_dict = dict() for member in members: attributes_dict[member] = getattr(instance_of_class, member) return attributes_dict def sha1_hash(value): # convert string to bytes value = str.encode(value) # calculate a SHA1 hash hash_object = hashlib.sha1(value) hashed_value = hash_object.hexdigest() return hashed_value <commit_msg>[UPDATE] Add descriptive docstring comments global functions<commit_after>
import random import hashlib def get_random_id(): """generates a random integer value between 1 and 100000000 :return (int): randomly generated integer """ # generate a random unique integer random_id = random.randrange(1, 100000000) return random_id def get_attributes_from_class(instance_of_class): """Get attributes from a class objects and returns a dictionary containing the attribute name as (key) and the attribute value as (value) :arg instance_of_class: An object :return (dict): Attribute name as (key) and the attribute value as (value) """ # get a list of member attributes of class members = [attr for attr in dir(instance_of_class) if not callable(getattr(instance_of_class, attr)) and not attr.startswith("__")] # loop through members array and add the member value to the attributes dictionary attributes_dict = dict() for member in members: attributes_dict[member] = getattr(instance_of_class, member) return attributes_dict def sha1_hash(value): """Calculates the SHA1 has of a string :arg: value (str): String to be hashed :return (str): SHA1 hash """ # convert string to bytes value = str.encode(value) # calculate a SHA1 hash hash_object = hashlib.sha1(value) hashed_value = hash_object.hexdigest() return hashed_value
import random import hashlib def get_random_id(): # generate a random unique integer random_id = random.randrange(1, 100000000) return random_id def get_attributes_from_class(instance_of_class): members = [attr for attr in dir(instance_of_class) if not callable(getattr(instance_of_class, attr)) and not attr.startswith("__")] attributes_dict = dict() for member in members: attributes_dict[member] = getattr(instance_of_class, member) return attributes_dict def sha1_hash(value): # convert string to bytes value = str.encode(value) # calculate a SHA1 hash hash_object = hashlib.sha1(value) hashed_value = hash_object.hexdigest() return hashed_value [UPDATE] Add descriptive docstring comments global functionsimport random import hashlib def get_random_id(): """generates a random integer value between 1 and 100000000 :return (int): randomly generated integer """ # generate a random unique integer random_id = random.randrange(1, 100000000) return random_id def get_attributes_from_class(instance_of_class): """Get attributes from a class objects and returns a dictionary containing the attribute name as (key) and the attribute value as (value) :arg instance_of_class: An object :return (dict): Attribute name as (key) and the attribute value as (value) """ # get a list of member attributes of class members = [attr for attr in dir(instance_of_class) if not callable(getattr(instance_of_class, attr)) and not attr.startswith("__")] # loop through members array and add the member value to the attributes dictionary attributes_dict = dict() for member in members: attributes_dict[member] = getattr(instance_of_class, member) return attributes_dict def sha1_hash(value): """Calculates the SHA1 has of a string :arg: value (str): String to be hashed :return (str): SHA1 hash """ # convert string to bytes value = str.encode(value) # calculate a SHA1 hash hash_object = hashlib.sha1(value) hashed_value = hash_object.hexdigest() return hashed_value
<commit_before>import random import hashlib def get_random_id(): # generate a random unique integer random_id = random.randrange(1, 100000000) return random_id def get_attributes_from_class(instance_of_class): members = [attr for attr in dir(instance_of_class) if not callable(getattr(instance_of_class, attr)) and not attr.startswith("__")] attributes_dict = dict() for member in members: attributes_dict[member] = getattr(instance_of_class, member) return attributes_dict def sha1_hash(value): # convert string to bytes value = str.encode(value) # calculate a SHA1 hash hash_object = hashlib.sha1(value) hashed_value = hash_object.hexdigest() return hashed_value <commit_msg>[UPDATE] Add descriptive docstring comments global functions<commit_after>import random import hashlib def get_random_id(): """generates a random integer value between 1 and 100000000 :return (int): randomly generated integer """ # generate a random unique integer random_id = random.randrange(1, 100000000) return random_id def get_attributes_from_class(instance_of_class): """Get attributes from a class objects and returns a dictionary containing the attribute name as (key) and the attribute value as (value) :arg instance_of_class: An object :return (dict): Attribute name as (key) and the attribute value as (value) """ # get a list of member attributes of class members = [attr for attr in dir(instance_of_class) if not callable(getattr(instance_of_class, attr)) and not attr.startswith("__")] # loop through members array and add the member value to the attributes dictionary attributes_dict = dict() for member in members: attributes_dict[member] = getattr(instance_of_class, member) return attributes_dict def sha1_hash(value): """Calculates the SHA1 has of a string :arg: value (str): String to be hashed :return (str): SHA1 hash """ # convert string to bytes value = str.encode(value) # calculate a SHA1 hash hash_object = hashlib.sha1(value) hashed_value = hash_object.hexdigest() return hashed_value
e9bec1aeac09dcb00fd423350f83bab82ea80ffc
connection_example.py
connection_example.py
import socket import threading import SocketServer class ThreadedTCPRequestHandler(SocketServer.BaseRequestHandler): def handle(self): data = self.request.recv(1024) cur_thread = threading.current_thread() response = "{}: {}".format(cur_thread.name, data) self.request.sendall(response) class ThreadedTCPServer(SocketServer.ThreadingMixIn, SocketServer.TCPServer): pass def client(ip, port, message): sock = socket.socket(socket.AF_INET, socket.SOCK_STREAM) sock.connect((ip, port)) try: sock.sendall(message) response = sock.recv(1024) print "Received: {}".format(response) finally: sock.close() def create_server(host, port): server = ThreadedTCPServer((host, port), ThreadedTCPRequestHandler) server_thread = threading.Thread(target=server.serve_forever) server_thread.daemon = True server_thread.start() print "Server loop running in thread:", server_thread.name return server if __name__ == "__main__": HOST, PORT = "localhost", 0 server = create_server(HOST, PORT) server2 = create_server(HOST, PORT) ip, port = server.server_address ip, port2 = server2.server_address client(ip, port, "Hi world") client(ip, port2, "Hullo world") client(ip, port, "Sup world") client(ip, port2, "Goodbye world") server.shutdown() server2.shutdown()
import socket import threading import SocketServer class ThreadedTCPRequestHandler(SocketServer.BaseRequestHandler): def handle(self): data = self.request.recv(1024) cur_thread = threading.current_thread() response = "{}: {}".format(cur_thread.name, data) self.request.sendall(response) class ThreadedTCPServer(SocketServer.ThreadingMixIn, SocketServer.TCPServer): pass def send_msg(ip, port, message): sock = socket.socket(socket.AF_INET, socket.SOCK_STREAM) sock.connect((ip, port)) try: sock.sendall(message) response = sock.recv(1024) print "Received: {}".format(response) finally: sock.close() def create_server(host, port): server = ThreadedTCPServer((host, port), ThreadedTCPRequestHandler) server_thread = threading.Thread(target=server.serve_forever) server_thread.daemon = True server_thread.start() return server if __name__ == "__main__": HOST, PORT = "localhost", 0 server_list = [create_server(HOST, PORT) for x in range(8)] address_list = [server.server_address for server in server_list] for ip, port in address_list: send_msg(ip, port, "I want {} fishes".format(3)) map(lambda server: server.shutdown(), server_list)
Update example with 8 servers.
Update example with 8 servers.
Python
mit
Tribler/decentral-market
import socket import threading import SocketServer class ThreadedTCPRequestHandler(SocketServer.BaseRequestHandler): def handle(self): data = self.request.recv(1024) cur_thread = threading.current_thread() response = "{}: {}".format(cur_thread.name, data) self.request.sendall(response) class ThreadedTCPServer(SocketServer.ThreadingMixIn, SocketServer.TCPServer): pass def client(ip, port, message): sock = socket.socket(socket.AF_INET, socket.SOCK_STREAM) sock.connect((ip, port)) try: sock.sendall(message) response = sock.recv(1024) print "Received: {}".format(response) finally: sock.close() def create_server(host, port): server = ThreadedTCPServer((host, port), ThreadedTCPRequestHandler) server_thread = threading.Thread(target=server.serve_forever) server_thread.daemon = True server_thread.start() print "Server loop running in thread:", server_thread.name return server if __name__ == "__main__": HOST, PORT = "localhost", 0 server = create_server(HOST, PORT) server2 = create_server(HOST, PORT) ip, port = server.server_address ip, port2 = server2.server_address client(ip, port, "Hi world") client(ip, port2, "Hullo world") client(ip, port, "Sup world") client(ip, port2, "Goodbye world") server.shutdown() server2.shutdown() Update example with 8 servers.
import socket import threading import SocketServer class ThreadedTCPRequestHandler(SocketServer.BaseRequestHandler): def handle(self): data = self.request.recv(1024) cur_thread = threading.current_thread() response = "{}: {}".format(cur_thread.name, data) self.request.sendall(response) class ThreadedTCPServer(SocketServer.ThreadingMixIn, SocketServer.TCPServer): pass def send_msg(ip, port, message): sock = socket.socket(socket.AF_INET, socket.SOCK_STREAM) sock.connect((ip, port)) try: sock.sendall(message) response = sock.recv(1024) print "Received: {}".format(response) finally: sock.close() def create_server(host, port): server = ThreadedTCPServer((host, port), ThreadedTCPRequestHandler) server_thread = threading.Thread(target=server.serve_forever) server_thread.daemon = True server_thread.start() return server if __name__ == "__main__": HOST, PORT = "localhost", 0 server_list = [create_server(HOST, PORT) for x in range(8)] address_list = [server.server_address for server in server_list] for ip, port in address_list: send_msg(ip, port, "I want {} fishes".format(3)) map(lambda server: server.shutdown(), server_list)
<commit_before>import socket import threading import SocketServer class ThreadedTCPRequestHandler(SocketServer.BaseRequestHandler): def handle(self): data = self.request.recv(1024) cur_thread = threading.current_thread() response = "{}: {}".format(cur_thread.name, data) self.request.sendall(response) class ThreadedTCPServer(SocketServer.ThreadingMixIn, SocketServer.TCPServer): pass def client(ip, port, message): sock = socket.socket(socket.AF_INET, socket.SOCK_STREAM) sock.connect((ip, port)) try: sock.sendall(message) response = sock.recv(1024) print "Received: {}".format(response) finally: sock.close() def create_server(host, port): server = ThreadedTCPServer((host, port), ThreadedTCPRequestHandler) server_thread = threading.Thread(target=server.serve_forever) server_thread.daemon = True server_thread.start() print "Server loop running in thread:", server_thread.name return server if __name__ == "__main__": HOST, PORT = "localhost", 0 server = create_server(HOST, PORT) server2 = create_server(HOST, PORT) ip, port = server.server_address ip, port2 = server2.server_address client(ip, port, "Hi world") client(ip, port2, "Hullo world") client(ip, port, "Sup world") client(ip, port2, "Goodbye world") server.shutdown() server2.shutdown() <commit_msg>Update example with 8 servers.<commit_after>
import socket import threading import SocketServer class ThreadedTCPRequestHandler(SocketServer.BaseRequestHandler): def handle(self): data = self.request.recv(1024) cur_thread = threading.current_thread() response = "{}: {}".format(cur_thread.name, data) self.request.sendall(response) class ThreadedTCPServer(SocketServer.ThreadingMixIn, SocketServer.TCPServer): pass def send_msg(ip, port, message): sock = socket.socket(socket.AF_INET, socket.SOCK_STREAM) sock.connect((ip, port)) try: sock.sendall(message) response = sock.recv(1024) print "Received: {}".format(response) finally: sock.close() def create_server(host, port): server = ThreadedTCPServer((host, port), ThreadedTCPRequestHandler) server_thread = threading.Thread(target=server.serve_forever) server_thread.daemon = True server_thread.start() return server if __name__ == "__main__": HOST, PORT = "localhost", 0 server_list = [create_server(HOST, PORT) for x in range(8)] address_list = [server.server_address for server in server_list] for ip, port in address_list: send_msg(ip, port, "I want {} fishes".format(3)) map(lambda server: server.shutdown(), server_list)
import socket import threading import SocketServer class ThreadedTCPRequestHandler(SocketServer.BaseRequestHandler): def handle(self): data = self.request.recv(1024) cur_thread = threading.current_thread() response = "{}: {}".format(cur_thread.name, data) self.request.sendall(response) class ThreadedTCPServer(SocketServer.ThreadingMixIn, SocketServer.TCPServer): pass def client(ip, port, message): sock = socket.socket(socket.AF_INET, socket.SOCK_STREAM) sock.connect((ip, port)) try: sock.sendall(message) response = sock.recv(1024) print "Received: {}".format(response) finally: sock.close() def create_server(host, port): server = ThreadedTCPServer((host, port), ThreadedTCPRequestHandler) server_thread = threading.Thread(target=server.serve_forever) server_thread.daemon = True server_thread.start() print "Server loop running in thread:", server_thread.name return server if __name__ == "__main__": HOST, PORT = "localhost", 0 server = create_server(HOST, PORT) server2 = create_server(HOST, PORT) ip, port = server.server_address ip, port2 = server2.server_address client(ip, port, "Hi world") client(ip, port2, "Hullo world") client(ip, port, "Sup world") client(ip, port2, "Goodbye world") server.shutdown() server2.shutdown() Update example with 8 servers.import socket import threading import SocketServer class ThreadedTCPRequestHandler(SocketServer.BaseRequestHandler): def handle(self): data = self.request.recv(1024) cur_thread = threading.current_thread() response = "{}: {}".format(cur_thread.name, data) self.request.sendall(response) class ThreadedTCPServer(SocketServer.ThreadingMixIn, SocketServer.TCPServer): pass def send_msg(ip, port, message): sock = socket.socket(socket.AF_INET, socket.SOCK_STREAM) sock.connect((ip, port)) try: sock.sendall(message) response = sock.recv(1024) print "Received: {}".format(response) finally: sock.close() def create_server(host, port): server = ThreadedTCPServer((host, port), ThreadedTCPRequestHandler) server_thread = threading.Thread(target=server.serve_forever) server_thread.daemon = True server_thread.start() return server if __name__ == "__main__": HOST, PORT = "localhost", 0 server_list = [create_server(HOST, PORT) for x in range(8)] address_list = [server.server_address for server in server_list] for ip, port in address_list: send_msg(ip, port, "I want {} fishes".format(3)) map(lambda server: server.shutdown(), server_list)
<commit_before>import socket import threading import SocketServer class ThreadedTCPRequestHandler(SocketServer.BaseRequestHandler): def handle(self): data = self.request.recv(1024) cur_thread = threading.current_thread() response = "{}: {}".format(cur_thread.name, data) self.request.sendall(response) class ThreadedTCPServer(SocketServer.ThreadingMixIn, SocketServer.TCPServer): pass def client(ip, port, message): sock = socket.socket(socket.AF_INET, socket.SOCK_STREAM) sock.connect((ip, port)) try: sock.sendall(message) response = sock.recv(1024) print "Received: {}".format(response) finally: sock.close() def create_server(host, port): server = ThreadedTCPServer((host, port), ThreadedTCPRequestHandler) server_thread = threading.Thread(target=server.serve_forever) server_thread.daemon = True server_thread.start() print "Server loop running in thread:", server_thread.name return server if __name__ == "__main__": HOST, PORT = "localhost", 0 server = create_server(HOST, PORT) server2 = create_server(HOST, PORT) ip, port = server.server_address ip, port2 = server2.server_address client(ip, port, "Hi world") client(ip, port2, "Hullo world") client(ip, port, "Sup world") client(ip, port2, "Goodbye world") server.shutdown() server2.shutdown() <commit_msg>Update example with 8 servers.<commit_after>import socket import threading import SocketServer class ThreadedTCPRequestHandler(SocketServer.BaseRequestHandler): def handle(self): data = self.request.recv(1024) cur_thread = threading.current_thread() response = "{}: {}".format(cur_thread.name, data) self.request.sendall(response) class ThreadedTCPServer(SocketServer.ThreadingMixIn, SocketServer.TCPServer): pass def send_msg(ip, port, message): sock = socket.socket(socket.AF_INET, socket.SOCK_STREAM) sock.connect((ip, port)) try: sock.sendall(message) response = sock.recv(1024) print "Received: {}".format(response) finally: sock.close() def create_server(host, port): server = ThreadedTCPServer((host, port), ThreadedTCPRequestHandler) server_thread = threading.Thread(target=server.serve_forever) server_thread.daemon = True server_thread.start() return server if __name__ == "__main__": HOST, PORT = "localhost", 0 server_list = [create_server(HOST, PORT) for x in range(8)] address_list = [server.server_address for server in server_list] for ip, port in address_list: send_msg(ip, port, "I want {} fishes".format(3)) map(lambda server: server.shutdown(), server_list)
defbf149afa47910742a588292507535b2679f54
context_processors.py
context_processors.py
from django.conf import settings as django_settings from django.core.urlresolvers import resolve, reverse from django.utils.translation import activate, get_language def settings(request): return {'settings': django_settings} def alternate_seo_url(request): alternate_url = dict() path = request.path url_parts = resolve( path ) url = path cur_language = get_language() for lang_code, lang_name in django_settings.LANGUAGES : try: activate(lang_code) url = reverse( url_parts.view_name, kwargs=url_parts.kwargs ) alternate_url[lang_code] = django_settings.SITE_URL+url finally: activate(cur_language) return {'alternate':alternate_url}
from django.conf import settings as django_settings from django.core.urlresolvers import resolve, reverse from django.utils.translation import activate, get_language def settings(request): return {'settings': django_settings} def alternate_seo_url(request): alternate_url = dict() path = request.path url_parts = resolve( path ) if not url_parts.app_names: url = path cur_language = get_language() for lang_code, lang_name in django_settings.LANGUAGES : try: activate(lang_code) url = reverse( url_parts.view_name, kwargs=url_parts.kwargs ) alternate_url[lang_code] = django_settings.SITE_URL+url finally: activate(cur_language) return {'alternate':alternate_url}
Exclude nonapp from contextprocessor of alternate_seo
Exclude nonapp from contextprocessor of alternate_seo
Python
mit
lotrekagency/djlotrek,lotrekagency/djlotrek
from django.conf import settings as django_settings from django.core.urlresolvers import resolve, reverse from django.utils.translation import activate, get_language def settings(request): return {'settings': django_settings} def alternate_seo_url(request): alternate_url = dict() path = request.path url_parts = resolve( path ) url = path cur_language = get_language() for lang_code, lang_name in django_settings.LANGUAGES : try: activate(lang_code) url = reverse( url_parts.view_name, kwargs=url_parts.kwargs ) alternate_url[lang_code] = django_settings.SITE_URL+url finally: activate(cur_language) return {'alternate':alternate_url} Exclude nonapp from contextprocessor of alternate_seo
from django.conf import settings as django_settings from django.core.urlresolvers import resolve, reverse from django.utils.translation import activate, get_language def settings(request): return {'settings': django_settings} def alternate_seo_url(request): alternate_url = dict() path = request.path url_parts = resolve( path ) if not url_parts.app_names: url = path cur_language = get_language() for lang_code, lang_name in django_settings.LANGUAGES : try: activate(lang_code) url = reverse( url_parts.view_name, kwargs=url_parts.kwargs ) alternate_url[lang_code] = django_settings.SITE_URL+url finally: activate(cur_language) return {'alternate':alternate_url}
<commit_before>from django.conf import settings as django_settings from django.core.urlresolvers import resolve, reverse from django.utils.translation import activate, get_language def settings(request): return {'settings': django_settings} def alternate_seo_url(request): alternate_url = dict() path = request.path url_parts = resolve( path ) url = path cur_language = get_language() for lang_code, lang_name in django_settings.LANGUAGES : try: activate(lang_code) url = reverse( url_parts.view_name, kwargs=url_parts.kwargs ) alternate_url[lang_code] = django_settings.SITE_URL+url finally: activate(cur_language) return {'alternate':alternate_url} <commit_msg>Exclude nonapp from contextprocessor of alternate_seo<commit_after>
from django.conf import settings as django_settings from django.core.urlresolvers import resolve, reverse from django.utils.translation import activate, get_language def settings(request): return {'settings': django_settings} def alternate_seo_url(request): alternate_url = dict() path = request.path url_parts = resolve( path ) if not url_parts.app_names: url = path cur_language = get_language() for lang_code, lang_name in django_settings.LANGUAGES : try: activate(lang_code) url = reverse( url_parts.view_name, kwargs=url_parts.kwargs ) alternate_url[lang_code] = django_settings.SITE_URL+url finally: activate(cur_language) return {'alternate':alternate_url}
from django.conf import settings as django_settings from django.core.urlresolvers import resolve, reverse from django.utils.translation import activate, get_language def settings(request): return {'settings': django_settings} def alternate_seo_url(request): alternate_url = dict() path = request.path url_parts = resolve( path ) url = path cur_language = get_language() for lang_code, lang_name in django_settings.LANGUAGES : try: activate(lang_code) url = reverse( url_parts.view_name, kwargs=url_parts.kwargs ) alternate_url[lang_code] = django_settings.SITE_URL+url finally: activate(cur_language) return {'alternate':alternate_url} Exclude nonapp from contextprocessor of alternate_seofrom django.conf import settings as django_settings from django.core.urlresolvers import resolve, reverse from django.utils.translation import activate, get_language def settings(request): return {'settings': django_settings} def alternate_seo_url(request): alternate_url = dict() path = request.path url_parts = resolve( path ) if not url_parts.app_names: url = path cur_language = get_language() for lang_code, lang_name in django_settings.LANGUAGES : try: activate(lang_code) url = reverse( url_parts.view_name, kwargs=url_parts.kwargs ) alternate_url[lang_code] = django_settings.SITE_URL+url finally: activate(cur_language) return {'alternate':alternate_url}
<commit_before>from django.conf import settings as django_settings from django.core.urlresolvers import resolve, reverse from django.utils.translation import activate, get_language def settings(request): return {'settings': django_settings} def alternate_seo_url(request): alternate_url = dict() path = request.path url_parts = resolve( path ) url = path cur_language = get_language() for lang_code, lang_name in django_settings.LANGUAGES : try: activate(lang_code) url = reverse( url_parts.view_name, kwargs=url_parts.kwargs ) alternate_url[lang_code] = django_settings.SITE_URL+url finally: activate(cur_language) return {'alternate':alternate_url} <commit_msg>Exclude nonapp from contextprocessor of alternate_seo<commit_after>from django.conf import settings as django_settings from django.core.urlresolvers import resolve, reverse from django.utils.translation import activate, get_language def settings(request): return {'settings': django_settings} def alternate_seo_url(request): alternate_url = dict() path = request.path url_parts = resolve( path ) if not url_parts.app_names: url = path cur_language = get_language() for lang_code, lang_name in django_settings.LANGUAGES : try: activate(lang_code) url = reverse( url_parts.view_name, kwargs=url_parts.kwargs ) alternate_url[lang_code] = django_settings.SITE_URL+url finally: activate(cur_language) return {'alternate':alternate_url}
ed548ec91cfe65e9c3fecc9c6baa5b82486654bd
archlinux/archpack_settings.py
archlinux/archpack_settings.py
# # Biicode Arch Linux package settings. # # Check PKGBUILD_template docs for those settings and # what they mean. # def settings(): return { "version": "2.4", "release_number": "1", "arch_deps": ["cmake>=3.0.2", "zlib", "glibc", "sqlite", "wget", "python2-pmw" ], "debian_deps": ["zlib1g", "libc-bin", "libsqlite3-0", "wget", "lib32z1", "python-tk" ] } if __name__ == '__main__': print(settings())
# # Biicode Arch Linux package settings. # # Check PKGBUILD_template docs for those settings and # what they mean. # def settings(): return { "version": "2.4.1", "release_number": "1", "arch_deps": ["cmake>=3.0.2", "zlib", "glibc", "sqlite", "wget", "python2-pmw" ], "debian_deps": ["zlib1g", "libc-bin", "libsqlite3-0", "wget", "lib32z1", "python-tk" ] } if __name__ == '__main__': print(settings())
Update aur package to 2.4.1
Update aur package to 2.4.1
Python
bsd-2-clause
bowlofstew/packages,bowlofstew/packages,biicode/packages,biicode/packages
# # Biicode Arch Linux package settings. # # Check PKGBUILD_template docs for those settings and # what they mean. # def settings(): return { "version": "2.4", "release_number": "1", "arch_deps": ["cmake>=3.0.2", "zlib", "glibc", "sqlite", "wget", "python2-pmw" ], "debian_deps": ["zlib1g", "libc-bin", "libsqlite3-0", "wget", "lib32z1", "python-tk" ] } if __name__ == '__main__': print(settings()) Update aur package to 2.4.1
# # Biicode Arch Linux package settings. # # Check PKGBUILD_template docs for those settings and # what they mean. # def settings(): return { "version": "2.4.1", "release_number": "1", "arch_deps": ["cmake>=3.0.2", "zlib", "glibc", "sqlite", "wget", "python2-pmw" ], "debian_deps": ["zlib1g", "libc-bin", "libsqlite3-0", "wget", "lib32z1", "python-tk" ] } if __name__ == '__main__': print(settings())
<commit_before># # Biicode Arch Linux package settings. # # Check PKGBUILD_template docs for those settings and # what they mean. # def settings(): return { "version": "2.4", "release_number": "1", "arch_deps": ["cmake>=3.0.2", "zlib", "glibc", "sqlite", "wget", "python2-pmw" ], "debian_deps": ["zlib1g", "libc-bin", "libsqlite3-0", "wget", "lib32z1", "python-tk" ] } if __name__ == '__main__': print(settings()) <commit_msg>Update aur package to 2.4.1<commit_after>
# # Biicode Arch Linux package settings. # # Check PKGBUILD_template docs for those settings and # what they mean. # def settings(): return { "version": "2.4.1", "release_number": "1", "arch_deps": ["cmake>=3.0.2", "zlib", "glibc", "sqlite", "wget", "python2-pmw" ], "debian_deps": ["zlib1g", "libc-bin", "libsqlite3-0", "wget", "lib32z1", "python-tk" ] } if __name__ == '__main__': print(settings())
# # Biicode Arch Linux package settings. # # Check PKGBUILD_template docs for those settings and # what they mean. # def settings(): return { "version": "2.4", "release_number": "1", "arch_deps": ["cmake>=3.0.2", "zlib", "glibc", "sqlite", "wget", "python2-pmw" ], "debian_deps": ["zlib1g", "libc-bin", "libsqlite3-0", "wget", "lib32z1", "python-tk" ] } if __name__ == '__main__': print(settings()) Update aur package to 2.4.1# # Biicode Arch Linux package settings. # # Check PKGBUILD_template docs for those settings and # what they mean. # def settings(): return { "version": "2.4.1", "release_number": "1", "arch_deps": ["cmake>=3.0.2", "zlib", "glibc", "sqlite", "wget", "python2-pmw" ], "debian_deps": ["zlib1g", "libc-bin", "libsqlite3-0", "wget", "lib32z1", "python-tk" ] } if __name__ == '__main__': print(settings())
<commit_before># # Biicode Arch Linux package settings. # # Check PKGBUILD_template docs for those settings and # what they mean. # def settings(): return { "version": "2.4", "release_number": "1", "arch_deps": ["cmake>=3.0.2", "zlib", "glibc", "sqlite", "wget", "python2-pmw" ], "debian_deps": ["zlib1g", "libc-bin", "libsqlite3-0", "wget", "lib32z1", "python-tk" ] } if __name__ == '__main__': print(settings()) <commit_msg>Update aur package to 2.4.1<commit_after># # Biicode Arch Linux package settings. # # Check PKGBUILD_template docs for those settings and # what they mean. # def settings(): return { "version": "2.4.1", "release_number": "1", "arch_deps": ["cmake>=3.0.2", "zlib", "glibc", "sqlite", "wget", "python2-pmw" ], "debian_deps": ["zlib1g", "libc-bin", "libsqlite3-0", "wget", "lib32z1", "python-tk" ] } if __name__ == '__main__': print(settings())
6297ae8ffd257689c41c411ce3fa13512910b657
app/timer/views.py
app/timer/views.py
from django.views.generic import ListView, CreateView from django.utils.timezone import now from timer.models import Timer, Location, Station, Moon, System from timer.forms import TimerForm class TimerCreateView(CreateView): model = Timer form_class = TimerForm class TimerListView(ListView): model = Timer template_name = 'timer/timer_list.html' def get_queryset(self): qs = super(TimerListView, self).get_queryset().select_related('location', 'station', 'moon', 'system') if int(self.request.GET.get('all', 0)) == 0: qs = qs.filter(expiration__gt=now()) type = int(self.request.GET.get('type', 0)) if type == 1: qs = [m for m in qs if m.location.get_type == 'Station'] if type == 2: qs = [m for m in qs if m.location.get_type == 'System'] if type == 3: qs = [m for m in qs if m.location.get_type == 'Moon'] return qs def get_context_data(self, **kwargs): ctx = super(TimerListView, self).get_context_data(**kwargs) ctx.update({ 'list_all': int(self.request.GET.get('all', 0)), 'list_type': int(self.request.GET.get('type', 0)), }) return ctx
from django.views.generic import ListView, CreateView from django.utils.timezone import now from timer.models import Timer, Location, Station, Moon, System from timer.forms import TimerForm class TimerCreateView(CreateView): model = Timer form_class = TimerForm class TimerListView(ListView): model = Timer template_name = 'timer/timer_list.html' def get_queryset(self): qs = super(TimerListView, self).get_queryset().select_related('location', 'station', 'moon', 'system') if int(self.request.GET.get('all', 0)) == 0: qs = qs.filter(expiration__gt=now()) typ = int(self.request.GET.get('type', 0)) if typ == 1: qs = [m for m in qs if m.location.get_type == 'Station'] if typ == 2: qs = [m for m in qs if m.location.get_type == 'System'] if typ == 3: qs = [m for m in qs if m.location.get_type == 'Moon'] return qs def get_context_data(self, **kwargs): ctx = super(TimerListView, self).get_context_data(**kwargs) ctx.update({ 'list_all': int(self.request.GET.get('all', 0)), 'list_type': int(self.request.GET.get('type', 0)), }) return ctx
Fix bad usage of a reserved word
Fix bad usage of a reserved word
Python
bsd-3-clause
nikdoof/limetime,nikdoof/limetime
from django.views.generic import ListView, CreateView from django.utils.timezone import now from timer.models import Timer, Location, Station, Moon, System from timer.forms import TimerForm class TimerCreateView(CreateView): model = Timer form_class = TimerForm class TimerListView(ListView): model = Timer template_name = 'timer/timer_list.html' def get_queryset(self): qs = super(TimerListView, self).get_queryset().select_related('location', 'station', 'moon', 'system') if int(self.request.GET.get('all', 0)) == 0: qs = qs.filter(expiration__gt=now()) type = int(self.request.GET.get('type', 0)) if type == 1: qs = [m for m in qs if m.location.get_type == 'Station'] if type == 2: qs = [m for m in qs if m.location.get_type == 'System'] if type == 3: qs = [m for m in qs if m.location.get_type == 'Moon'] return qs def get_context_data(self, **kwargs): ctx = super(TimerListView, self).get_context_data(**kwargs) ctx.update({ 'list_all': int(self.request.GET.get('all', 0)), 'list_type': int(self.request.GET.get('type', 0)), }) return ctxFix bad usage of a reserved word
from django.views.generic import ListView, CreateView from django.utils.timezone import now from timer.models import Timer, Location, Station, Moon, System from timer.forms import TimerForm class TimerCreateView(CreateView): model = Timer form_class = TimerForm class TimerListView(ListView): model = Timer template_name = 'timer/timer_list.html' def get_queryset(self): qs = super(TimerListView, self).get_queryset().select_related('location', 'station', 'moon', 'system') if int(self.request.GET.get('all', 0)) == 0: qs = qs.filter(expiration__gt=now()) typ = int(self.request.GET.get('type', 0)) if typ == 1: qs = [m for m in qs if m.location.get_type == 'Station'] if typ == 2: qs = [m for m in qs if m.location.get_type == 'System'] if typ == 3: qs = [m for m in qs if m.location.get_type == 'Moon'] return qs def get_context_data(self, **kwargs): ctx = super(TimerListView, self).get_context_data(**kwargs) ctx.update({ 'list_all': int(self.request.GET.get('all', 0)), 'list_type': int(self.request.GET.get('type', 0)), }) return ctx
<commit_before>from django.views.generic import ListView, CreateView from django.utils.timezone import now from timer.models import Timer, Location, Station, Moon, System from timer.forms import TimerForm class TimerCreateView(CreateView): model = Timer form_class = TimerForm class TimerListView(ListView): model = Timer template_name = 'timer/timer_list.html' def get_queryset(self): qs = super(TimerListView, self).get_queryset().select_related('location', 'station', 'moon', 'system') if int(self.request.GET.get('all', 0)) == 0: qs = qs.filter(expiration__gt=now()) type = int(self.request.GET.get('type', 0)) if type == 1: qs = [m for m in qs if m.location.get_type == 'Station'] if type == 2: qs = [m for m in qs if m.location.get_type == 'System'] if type == 3: qs = [m for m in qs if m.location.get_type == 'Moon'] return qs def get_context_data(self, **kwargs): ctx = super(TimerListView, self).get_context_data(**kwargs) ctx.update({ 'list_all': int(self.request.GET.get('all', 0)), 'list_type': int(self.request.GET.get('type', 0)), }) return ctx<commit_msg>Fix bad usage of a reserved word<commit_after>
from django.views.generic import ListView, CreateView from django.utils.timezone import now from timer.models import Timer, Location, Station, Moon, System from timer.forms import TimerForm class TimerCreateView(CreateView): model = Timer form_class = TimerForm class TimerListView(ListView): model = Timer template_name = 'timer/timer_list.html' def get_queryset(self): qs = super(TimerListView, self).get_queryset().select_related('location', 'station', 'moon', 'system') if int(self.request.GET.get('all', 0)) == 0: qs = qs.filter(expiration__gt=now()) typ = int(self.request.GET.get('type', 0)) if typ == 1: qs = [m for m in qs if m.location.get_type == 'Station'] if typ == 2: qs = [m for m in qs if m.location.get_type == 'System'] if typ == 3: qs = [m for m in qs if m.location.get_type == 'Moon'] return qs def get_context_data(self, **kwargs): ctx = super(TimerListView, self).get_context_data(**kwargs) ctx.update({ 'list_all': int(self.request.GET.get('all', 0)), 'list_type': int(self.request.GET.get('type', 0)), }) return ctx
from django.views.generic import ListView, CreateView from django.utils.timezone import now from timer.models import Timer, Location, Station, Moon, System from timer.forms import TimerForm class TimerCreateView(CreateView): model = Timer form_class = TimerForm class TimerListView(ListView): model = Timer template_name = 'timer/timer_list.html' def get_queryset(self): qs = super(TimerListView, self).get_queryset().select_related('location', 'station', 'moon', 'system') if int(self.request.GET.get('all', 0)) == 0: qs = qs.filter(expiration__gt=now()) type = int(self.request.GET.get('type', 0)) if type == 1: qs = [m for m in qs if m.location.get_type == 'Station'] if type == 2: qs = [m for m in qs if m.location.get_type == 'System'] if type == 3: qs = [m for m in qs if m.location.get_type == 'Moon'] return qs def get_context_data(self, **kwargs): ctx = super(TimerListView, self).get_context_data(**kwargs) ctx.update({ 'list_all': int(self.request.GET.get('all', 0)), 'list_type': int(self.request.GET.get('type', 0)), }) return ctxFix bad usage of a reserved wordfrom django.views.generic import ListView, CreateView from django.utils.timezone import now from timer.models import Timer, Location, Station, Moon, System from timer.forms import TimerForm class TimerCreateView(CreateView): model = Timer form_class = TimerForm class TimerListView(ListView): model = Timer template_name = 'timer/timer_list.html' def get_queryset(self): qs = super(TimerListView, self).get_queryset().select_related('location', 'station', 'moon', 'system') if int(self.request.GET.get('all', 0)) == 0: qs = qs.filter(expiration__gt=now()) typ = int(self.request.GET.get('type', 0)) if typ == 1: qs = [m for m in qs if m.location.get_type == 'Station'] if typ == 2: qs = [m for m in qs if m.location.get_type == 'System'] if typ == 3: qs = [m for m in qs if m.location.get_type == 'Moon'] return qs def get_context_data(self, **kwargs): ctx = super(TimerListView, self).get_context_data(**kwargs) ctx.update({ 'list_all': int(self.request.GET.get('all', 0)), 'list_type': int(self.request.GET.get('type', 0)), }) return ctx
<commit_before>from django.views.generic import ListView, CreateView from django.utils.timezone import now from timer.models import Timer, Location, Station, Moon, System from timer.forms import TimerForm class TimerCreateView(CreateView): model = Timer form_class = TimerForm class TimerListView(ListView): model = Timer template_name = 'timer/timer_list.html' def get_queryset(self): qs = super(TimerListView, self).get_queryset().select_related('location', 'station', 'moon', 'system') if int(self.request.GET.get('all', 0)) == 0: qs = qs.filter(expiration__gt=now()) type = int(self.request.GET.get('type', 0)) if type == 1: qs = [m for m in qs if m.location.get_type == 'Station'] if type == 2: qs = [m for m in qs if m.location.get_type == 'System'] if type == 3: qs = [m for m in qs if m.location.get_type == 'Moon'] return qs def get_context_data(self, **kwargs): ctx = super(TimerListView, self).get_context_data(**kwargs) ctx.update({ 'list_all': int(self.request.GET.get('all', 0)), 'list_type': int(self.request.GET.get('type', 0)), }) return ctx<commit_msg>Fix bad usage of a reserved word<commit_after>from django.views.generic import ListView, CreateView from django.utils.timezone import now from timer.models import Timer, Location, Station, Moon, System from timer.forms import TimerForm class TimerCreateView(CreateView): model = Timer form_class = TimerForm class TimerListView(ListView): model = Timer template_name = 'timer/timer_list.html' def get_queryset(self): qs = super(TimerListView, self).get_queryset().select_related('location', 'station', 'moon', 'system') if int(self.request.GET.get('all', 0)) == 0: qs = qs.filter(expiration__gt=now()) typ = int(self.request.GET.get('type', 0)) if typ == 1: qs = [m for m in qs if m.location.get_type == 'Station'] if typ == 2: qs = [m for m in qs if m.location.get_type == 'System'] if typ == 3: qs = [m for m in qs if m.location.get_type == 'Moon'] return qs def get_context_data(self, **kwargs): ctx = super(TimerListView, self).get_context_data(**kwargs) ctx.update({ 'list_all': int(self.request.GET.get('all', 0)), 'list_type': int(self.request.GET.get('type', 0)), }) return ctx
072f69edbb0ee959ff3a6a5ca8e3ac6d2e9d45ad
setup.py
setup.py
#!/usr/bin/env python from setuptools import setup, find_packages # Get version string with open('gdx2py/version.py') as f: exec(f.read()) setup(name='GDX2py', version=__version__, author='Erkka Rinne', author_email='[email protected]', description='Read and write GAMS Data eXchange (GDX) files using Python', python_requires='>=3.6', install_requires=[ 'gdxcc>=7', ], setup_requires=['pytest-runner'], tests_require=['pytest', 'pytest-datadir'], url='https://github.com/ererkka/GDX2py', packages=find_packages(), )
#!/usr/bin/env python from setuptools import setup, find_packages # Get version string with open('gdx2py/version.py') as f: exec(f.read()) setup(name='GDX2py', version=__version__, author='Erkka Rinne', author_email='[email protected]', description='Read and write GAMS Data eXchange (GDX) files using Python', python_requires='>=3.6', install_requires=[ 'gdxcc>=7', ], setup_requires=['pytest-runner'], tests_require=['pytest', 'pytest-datadir'], url='https://github.com/ererkka/GDX2py', packages=find_packages(exclude=['tests']), )
Exclude tests from built distribution
Exclude tests from built distribution
Python
mit
ererkka/GDX2py
#!/usr/bin/env python from setuptools import setup, find_packages # Get version string with open('gdx2py/version.py') as f: exec(f.read()) setup(name='GDX2py', version=__version__, author='Erkka Rinne', author_email='[email protected]', description='Read and write GAMS Data eXchange (GDX) files using Python', python_requires='>=3.6', install_requires=[ 'gdxcc>=7', ], setup_requires=['pytest-runner'], tests_require=['pytest', 'pytest-datadir'], url='https://github.com/ererkka/GDX2py', packages=find_packages(), ) Exclude tests from built distribution
#!/usr/bin/env python from setuptools import setup, find_packages # Get version string with open('gdx2py/version.py') as f: exec(f.read()) setup(name='GDX2py', version=__version__, author='Erkka Rinne', author_email='[email protected]', description='Read and write GAMS Data eXchange (GDX) files using Python', python_requires='>=3.6', install_requires=[ 'gdxcc>=7', ], setup_requires=['pytest-runner'], tests_require=['pytest', 'pytest-datadir'], url='https://github.com/ererkka/GDX2py', packages=find_packages(exclude=['tests']), )
<commit_before>#!/usr/bin/env python from setuptools import setup, find_packages # Get version string with open('gdx2py/version.py') as f: exec(f.read()) setup(name='GDX2py', version=__version__, author='Erkka Rinne', author_email='[email protected]', description='Read and write GAMS Data eXchange (GDX) files using Python', python_requires='>=3.6', install_requires=[ 'gdxcc>=7', ], setup_requires=['pytest-runner'], tests_require=['pytest', 'pytest-datadir'], url='https://github.com/ererkka/GDX2py', packages=find_packages(), ) <commit_msg>Exclude tests from built distribution<commit_after>
#!/usr/bin/env python from setuptools import setup, find_packages # Get version string with open('gdx2py/version.py') as f: exec(f.read()) setup(name='GDX2py', version=__version__, author='Erkka Rinne', author_email='[email protected]', description='Read and write GAMS Data eXchange (GDX) files using Python', python_requires='>=3.6', install_requires=[ 'gdxcc>=7', ], setup_requires=['pytest-runner'], tests_require=['pytest', 'pytest-datadir'], url='https://github.com/ererkka/GDX2py', packages=find_packages(exclude=['tests']), )
#!/usr/bin/env python from setuptools import setup, find_packages # Get version string with open('gdx2py/version.py') as f: exec(f.read()) setup(name='GDX2py', version=__version__, author='Erkka Rinne', author_email='[email protected]', description='Read and write GAMS Data eXchange (GDX) files using Python', python_requires='>=3.6', install_requires=[ 'gdxcc>=7', ], setup_requires=['pytest-runner'], tests_require=['pytest', 'pytest-datadir'], url='https://github.com/ererkka/GDX2py', packages=find_packages(), ) Exclude tests from built distribution#!/usr/bin/env python from setuptools import setup, find_packages # Get version string with open('gdx2py/version.py') as f: exec(f.read()) setup(name='GDX2py', version=__version__, author='Erkka Rinne', author_email='[email protected]', description='Read and write GAMS Data eXchange (GDX) files using Python', python_requires='>=3.6', install_requires=[ 'gdxcc>=7', ], setup_requires=['pytest-runner'], tests_require=['pytest', 'pytest-datadir'], url='https://github.com/ererkka/GDX2py', packages=find_packages(exclude=['tests']), )
<commit_before>#!/usr/bin/env python from setuptools import setup, find_packages # Get version string with open('gdx2py/version.py') as f: exec(f.read()) setup(name='GDX2py', version=__version__, author='Erkka Rinne', author_email='[email protected]', description='Read and write GAMS Data eXchange (GDX) files using Python', python_requires='>=3.6', install_requires=[ 'gdxcc>=7', ], setup_requires=['pytest-runner'], tests_require=['pytest', 'pytest-datadir'], url='https://github.com/ererkka/GDX2py', packages=find_packages(), ) <commit_msg>Exclude tests from built distribution<commit_after>#!/usr/bin/env python from setuptools import setup, find_packages # Get version string with open('gdx2py/version.py') as f: exec(f.read()) setup(name='GDX2py', version=__version__, author='Erkka Rinne', author_email='[email protected]', description='Read and write GAMS Data eXchange (GDX) files using Python', python_requires='>=3.6', install_requires=[ 'gdxcc>=7', ], setup_requires=['pytest-runner'], tests_require=['pytest', 'pytest-datadir'], url='https://github.com/ererkka/GDX2py', packages=find_packages(exclude=['tests']), )
5bfaf83045587e5c7d1d70bf98b3b1eb1a1d10ed
setup.py
setup.py
from setuptools import setup setup( name='pytest-ui', description='Text User Interface for running python tests', version='0.1', license='MIT', platforms=['linux', 'osx', 'win32'], packages=['pytui'], url='https://github.com/martinsmid/pytest-ui', author_email='[email protected]', author='Martin Smid', entry_points={ 'pytest11': [ 'pytui = pytui.runner', ] }, install_requires=['urwid>=1.3.1,pytest>=3.0.5'], classifiers=[ 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', 'Operating System :: POSIX', 'Operating System :: Microsoft :: Windows', 'Operating System :: MacOS :: MacOS X', 'Topic :: Software Development :: Testing', 'Topic :: Utilities', 'Programming Language :: Python', ], )
from setuptools import setup setup( name='pytest-ui', description='Text User Interface for running python tests', version='0.1', license='MIT', platforms=['linux', 'osx', 'win32'], packages=['pytui'], url='https://github.com/martinsmid/pytest-ui', author_email='[email protected]', author='Martin Smid', entry_points={ 'pytest11': [ 'pytui = pytui.runner', ] }, install_requires=['urwid>=1.3.1', 'pytest>=3.0.5'], classifiers=[ 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', 'Operating System :: POSIX', 'Operating System :: Microsoft :: Windows', 'Operating System :: MacOS :: MacOS X', 'Topic :: Software Development :: Testing', 'Topic :: Utilities', 'Programming Language :: Python', ], )
Split requires into own string
Split requires into own string
Python
mit
martinsmid/pytest-ui
from setuptools import setup setup( name='pytest-ui', description='Text User Interface for running python tests', version='0.1', license='MIT', platforms=['linux', 'osx', 'win32'], packages=['pytui'], url='https://github.com/martinsmid/pytest-ui', author_email='[email protected]', author='Martin Smid', entry_points={ 'pytest11': [ 'pytui = pytui.runner', ] }, install_requires=['urwid>=1.3.1,pytest>=3.0.5'], classifiers=[ 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', 'Operating System :: POSIX', 'Operating System :: Microsoft :: Windows', 'Operating System :: MacOS :: MacOS X', 'Topic :: Software Development :: Testing', 'Topic :: Utilities', 'Programming Language :: Python', ], ) Split requires into own string
from setuptools import setup setup( name='pytest-ui', description='Text User Interface for running python tests', version='0.1', license='MIT', platforms=['linux', 'osx', 'win32'], packages=['pytui'], url='https://github.com/martinsmid/pytest-ui', author_email='[email protected]', author='Martin Smid', entry_points={ 'pytest11': [ 'pytui = pytui.runner', ] }, install_requires=['urwid>=1.3.1', 'pytest>=3.0.5'], classifiers=[ 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', 'Operating System :: POSIX', 'Operating System :: Microsoft :: Windows', 'Operating System :: MacOS :: MacOS X', 'Topic :: Software Development :: Testing', 'Topic :: Utilities', 'Programming Language :: Python', ], )
<commit_before>from setuptools import setup setup( name='pytest-ui', description='Text User Interface for running python tests', version='0.1', license='MIT', platforms=['linux', 'osx', 'win32'], packages=['pytui'], url='https://github.com/martinsmid/pytest-ui', author_email='[email protected]', author='Martin Smid', entry_points={ 'pytest11': [ 'pytui = pytui.runner', ] }, install_requires=['urwid>=1.3.1,pytest>=3.0.5'], classifiers=[ 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', 'Operating System :: POSIX', 'Operating System :: Microsoft :: Windows', 'Operating System :: MacOS :: MacOS X', 'Topic :: Software Development :: Testing', 'Topic :: Utilities', 'Programming Language :: Python', ], ) <commit_msg>Split requires into own string<commit_after>
from setuptools import setup setup( name='pytest-ui', description='Text User Interface for running python tests', version='0.1', license='MIT', platforms=['linux', 'osx', 'win32'], packages=['pytui'], url='https://github.com/martinsmid/pytest-ui', author_email='[email protected]', author='Martin Smid', entry_points={ 'pytest11': [ 'pytui = pytui.runner', ] }, install_requires=['urwid>=1.3.1', 'pytest>=3.0.5'], classifiers=[ 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', 'Operating System :: POSIX', 'Operating System :: Microsoft :: Windows', 'Operating System :: MacOS :: MacOS X', 'Topic :: Software Development :: Testing', 'Topic :: Utilities', 'Programming Language :: Python', ], )
from setuptools import setup setup( name='pytest-ui', description='Text User Interface for running python tests', version='0.1', license='MIT', platforms=['linux', 'osx', 'win32'], packages=['pytui'], url='https://github.com/martinsmid/pytest-ui', author_email='[email protected]', author='Martin Smid', entry_points={ 'pytest11': [ 'pytui = pytui.runner', ] }, install_requires=['urwid>=1.3.1,pytest>=3.0.5'], classifiers=[ 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', 'Operating System :: POSIX', 'Operating System :: Microsoft :: Windows', 'Operating System :: MacOS :: MacOS X', 'Topic :: Software Development :: Testing', 'Topic :: Utilities', 'Programming Language :: Python', ], ) Split requires into own stringfrom setuptools import setup setup( name='pytest-ui', description='Text User Interface for running python tests', version='0.1', license='MIT', platforms=['linux', 'osx', 'win32'], packages=['pytui'], url='https://github.com/martinsmid/pytest-ui', author_email='[email protected]', author='Martin Smid', entry_points={ 'pytest11': [ 'pytui = pytui.runner', ] }, install_requires=['urwid>=1.3.1', 'pytest>=3.0.5'], classifiers=[ 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', 'Operating System :: POSIX', 'Operating System :: Microsoft :: Windows', 'Operating System :: MacOS :: MacOS X', 'Topic :: Software Development :: Testing', 'Topic :: Utilities', 'Programming Language :: Python', ], )
<commit_before>from setuptools import setup setup( name='pytest-ui', description='Text User Interface for running python tests', version='0.1', license='MIT', platforms=['linux', 'osx', 'win32'], packages=['pytui'], url='https://github.com/martinsmid/pytest-ui', author_email='[email protected]', author='Martin Smid', entry_points={ 'pytest11': [ 'pytui = pytui.runner', ] }, install_requires=['urwid>=1.3.1,pytest>=3.0.5'], classifiers=[ 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', 'Operating System :: POSIX', 'Operating System :: Microsoft :: Windows', 'Operating System :: MacOS :: MacOS X', 'Topic :: Software Development :: Testing', 'Topic :: Utilities', 'Programming Language :: Python', ], ) <commit_msg>Split requires into own string<commit_after>from setuptools import setup setup( name='pytest-ui', description='Text User Interface for running python tests', version='0.1', license='MIT', platforms=['linux', 'osx', 'win32'], packages=['pytui'], url='https://github.com/martinsmid/pytest-ui', author_email='[email protected]', author='Martin Smid', entry_points={ 'pytest11': [ 'pytui = pytui.runner', ] }, install_requires=['urwid>=1.3.1', 'pytest>=3.0.5'], classifiers=[ 'Development Status :: 4 - Beta', 'Intended Audience :: Developers', 'Operating System :: POSIX', 'Operating System :: Microsoft :: Windows', 'Operating System :: MacOS :: MacOS X', 'Topic :: Software Development :: Testing', 'Topic :: Utilities', 'Programming Language :: Python', ], )
02b761e34c6cc26dc22f3d4f46de6a5b35731f78
setup.py
setup.py
from setuptools import setup from os import path here = path.abspath(path.dirname(__file__)) with open(path.join(here, 'README.md')) as f: jgo_long_description = f.read() setup( name='jgo', version='0.2.0', author='Philipp Hanslovsky, Curtis Rueden', author_email='[email protected]', description='Launch Java code from Python and the CLI, installation-free.', long_description=jgo_long_description, long_description_content_type='text/markdown', license='Public domain', url='https://github.com/scijava/jgo', packages=['jgo'], entry_points={ 'console_scripts': [ 'jgo=jgo.jgo:jgo_main' ] }, python_requires='>=3', )
from setuptools import setup from os import path here = path.abspath(path.dirname(__file__)) with open(path.join(here, 'README.md')) as f: jgo_long_description = f.read() setup( name='jgo', version='0.2.1.dev0', author='Philipp Hanslovsky, Curtis Rueden', author_email='[email protected]', description='Launch Java code from Python and the CLI, installation-free.', long_description=jgo_long_description, long_description_content_type='text/markdown', license='Public domain', url='https://github.com/scijava/jgo', packages=['jgo'], entry_points={ 'console_scripts': [ 'jgo=jgo.jgo:jgo_main' ] }, python_requires='>=3', )
Bump to next development cycle
Bump to next development cycle
Python
unlicense
ctrueden/jrun,ctrueden/jrun
from setuptools import setup from os import path here = path.abspath(path.dirname(__file__)) with open(path.join(here, 'README.md')) as f: jgo_long_description = f.read() setup( name='jgo', version='0.2.0', author='Philipp Hanslovsky, Curtis Rueden', author_email='[email protected]', description='Launch Java code from Python and the CLI, installation-free.', long_description=jgo_long_description, long_description_content_type='text/markdown', license='Public domain', url='https://github.com/scijava/jgo', packages=['jgo'], entry_points={ 'console_scripts': [ 'jgo=jgo.jgo:jgo_main' ] }, python_requires='>=3', ) Bump to next development cycle
from setuptools import setup from os import path here = path.abspath(path.dirname(__file__)) with open(path.join(here, 'README.md')) as f: jgo_long_description = f.read() setup( name='jgo', version='0.2.1.dev0', author='Philipp Hanslovsky, Curtis Rueden', author_email='[email protected]', description='Launch Java code from Python and the CLI, installation-free.', long_description=jgo_long_description, long_description_content_type='text/markdown', license='Public domain', url='https://github.com/scijava/jgo', packages=['jgo'], entry_points={ 'console_scripts': [ 'jgo=jgo.jgo:jgo_main' ] }, python_requires='>=3', )
<commit_before>from setuptools import setup from os import path here = path.abspath(path.dirname(__file__)) with open(path.join(here, 'README.md')) as f: jgo_long_description = f.read() setup( name='jgo', version='0.2.0', author='Philipp Hanslovsky, Curtis Rueden', author_email='[email protected]', description='Launch Java code from Python and the CLI, installation-free.', long_description=jgo_long_description, long_description_content_type='text/markdown', license='Public domain', url='https://github.com/scijava/jgo', packages=['jgo'], entry_points={ 'console_scripts': [ 'jgo=jgo.jgo:jgo_main' ] }, python_requires='>=3', ) <commit_msg>Bump to next development cycle<commit_after>
from setuptools import setup from os import path here = path.abspath(path.dirname(__file__)) with open(path.join(here, 'README.md')) as f: jgo_long_description = f.read() setup( name='jgo', version='0.2.1.dev0', author='Philipp Hanslovsky, Curtis Rueden', author_email='[email protected]', description='Launch Java code from Python and the CLI, installation-free.', long_description=jgo_long_description, long_description_content_type='text/markdown', license='Public domain', url='https://github.com/scijava/jgo', packages=['jgo'], entry_points={ 'console_scripts': [ 'jgo=jgo.jgo:jgo_main' ] }, python_requires='>=3', )
from setuptools import setup from os import path here = path.abspath(path.dirname(__file__)) with open(path.join(here, 'README.md')) as f: jgo_long_description = f.read() setup( name='jgo', version='0.2.0', author='Philipp Hanslovsky, Curtis Rueden', author_email='[email protected]', description='Launch Java code from Python and the CLI, installation-free.', long_description=jgo_long_description, long_description_content_type='text/markdown', license='Public domain', url='https://github.com/scijava/jgo', packages=['jgo'], entry_points={ 'console_scripts': [ 'jgo=jgo.jgo:jgo_main' ] }, python_requires='>=3', ) Bump to next development cyclefrom setuptools import setup from os import path here = path.abspath(path.dirname(__file__)) with open(path.join(here, 'README.md')) as f: jgo_long_description = f.read() setup( name='jgo', version='0.2.1.dev0', author='Philipp Hanslovsky, Curtis Rueden', author_email='[email protected]', description='Launch Java code from Python and the CLI, installation-free.', long_description=jgo_long_description, long_description_content_type='text/markdown', license='Public domain', url='https://github.com/scijava/jgo', packages=['jgo'], entry_points={ 'console_scripts': [ 'jgo=jgo.jgo:jgo_main' ] }, python_requires='>=3', )
<commit_before>from setuptools import setup from os import path here = path.abspath(path.dirname(__file__)) with open(path.join(here, 'README.md')) as f: jgo_long_description = f.read() setup( name='jgo', version='0.2.0', author='Philipp Hanslovsky, Curtis Rueden', author_email='[email protected]', description='Launch Java code from Python and the CLI, installation-free.', long_description=jgo_long_description, long_description_content_type='text/markdown', license='Public domain', url='https://github.com/scijava/jgo', packages=['jgo'], entry_points={ 'console_scripts': [ 'jgo=jgo.jgo:jgo_main' ] }, python_requires='>=3', ) <commit_msg>Bump to next development cycle<commit_after>from setuptools import setup from os import path here = path.abspath(path.dirname(__file__)) with open(path.join(here, 'README.md')) as f: jgo_long_description = f.read() setup( name='jgo', version='0.2.1.dev0', author='Philipp Hanslovsky, Curtis Rueden', author_email='[email protected]', description='Launch Java code from Python and the CLI, installation-free.', long_description=jgo_long_description, long_description_content_type='text/markdown', license='Public domain', url='https://github.com/scijava/jgo', packages=['jgo'], entry_points={ 'console_scripts': [ 'jgo=jgo.jgo:jgo_main' ] }, python_requires='>=3', )
5eb03f5ebc33cb13d80757f7b44330ef6b56b902
setup.py
setup.py
#!/usr/bin/env python from setuptools import setup with open('README.md', 'r') as readme_f: long_description = readme_f.read() setup( name='py-wasapi-client', version='1.1.0', url='https://github.com/unt-libraries/py-wasapi-client', author='University of North Texas Libraries', author_email='[email protected]', license='BSD', py_modules=['wasapi_client'], scripts=['wasapi_client.py'], description='A client for the [Archive-It] WASAPI Data Transer API', long_description=long_description, long_description_content_type='text/markdown', install_requires=['requests>=2.18.1'], entry_points={ 'console_scripts': [ 'wasapi-client=wasapi_client:main' ] }, setup_requires=['pytest-runner'], tests_require=['pytest'], classifiers=[ 'Intended Audience :: System Administrators', 'License :: OSI Approved :: BSD License', 'Natural Language :: English', 'Programming Language :: Python', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', 'Programming Language :: Python :: 3.6', 'Programming Language :: Python :: 3.7', 'Topic :: Communications :: File Sharing', ], )
#!/usr/bin/env python from setuptools import setup with open('README.md', 'r') as readme_f: long_description = readme_f.read() setup( name='py-wasapi-client', version='1.1.0', url='https://github.com/unt-libraries/py-wasapi-client', author='University of North Texas Libraries', author_email='[email protected]', license='BSD', py_modules=['wasapi_client'], scripts=['wasapi_client.py'], description='A client for the Archive-It and Webrecorder WASAPI Data Transer API', long_description=long_description, long_description_content_type='text/markdown', install_requires=['requests>=2.18.1'], entry_points={ 'console_scripts': [ 'wasapi-client=wasapi_client:main' ] }, setup_requires=['pytest-runner'], tests_require=['pytest'], classifiers=[ 'Intended Audience :: System Administrators', 'License :: OSI Approved :: BSD License', 'Natural Language :: English', 'Programming Language :: Python', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', 'Programming Language :: Python :: 3.6', 'Programming Language :: Python :: 3.7', 'Topic :: Communications :: File Sharing', ], )
Add Webrecorder to short description
Add Webrecorder to short description
Python
bsd-3-clause
unt-libraries/py-wasapi-client
#!/usr/bin/env python from setuptools import setup with open('README.md', 'r') as readme_f: long_description = readme_f.read() setup( name='py-wasapi-client', version='1.1.0', url='https://github.com/unt-libraries/py-wasapi-client', author='University of North Texas Libraries', author_email='[email protected]', license='BSD', py_modules=['wasapi_client'], scripts=['wasapi_client.py'], description='A client for the [Archive-It] WASAPI Data Transer API', long_description=long_description, long_description_content_type='text/markdown', install_requires=['requests>=2.18.1'], entry_points={ 'console_scripts': [ 'wasapi-client=wasapi_client:main' ] }, setup_requires=['pytest-runner'], tests_require=['pytest'], classifiers=[ 'Intended Audience :: System Administrators', 'License :: OSI Approved :: BSD License', 'Natural Language :: English', 'Programming Language :: Python', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', 'Programming Language :: Python :: 3.6', 'Programming Language :: Python :: 3.7', 'Topic :: Communications :: File Sharing', ], ) Add Webrecorder to short description
#!/usr/bin/env python from setuptools import setup with open('README.md', 'r') as readme_f: long_description = readme_f.read() setup( name='py-wasapi-client', version='1.1.0', url='https://github.com/unt-libraries/py-wasapi-client', author='University of North Texas Libraries', author_email='[email protected]', license='BSD', py_modules=['wasapi_client'], scripts=['wasapi_client.py'], description='A client for the Archive-It and Webrecorder WASAPI Data Transer API', long_description=long_description, long_description_content_type='text/markdown', install_requires=['requests>=2.18.1'], entry_points={ 'console_scripts': [ 'wasapi-client=wasapi_client:main' ] }, setup_requires=['pytest-runner'], tests_require=['pytest'], classifiers=[ 'Intended Audience :: System Administrators', 'License :: OSI Approved :: BSD License', 'Natural Language :: English', 'Programming Language :: Python', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', 'Programming Language :: Python :: 3.6', 'Programming Language :: Python :: 3.7', 'Topic :: Communications :: File Sharing', ], )
<commit_before>#!/usr/bin/env python from setuptools import setup with open('README.md', 'r') as readme_f: long_description = readme_f.read() setup( name='py-wasapi-client', version='1.1.0', url='https://github.com/unt-libraries/py-wasapi-client', author='University of North Texas Libraries', author_email='[email protected]', license='BSD', py_modules=['wasapi_client'], scripts=['wasapi_client.py'], description='A client for the [Archive-It] WASAPI Data Transer API', long_description=long_description, long_description_content_type='text/markdown', install_requires=['requests>=2.18.1'], entry_points={ 'console_scripts': [ 'wasapi-client=wasapi_client:main' ] }, setup_requires=['pytest-runner'], tests_require=['pytest'], classifiers=[ 'Intended Audience :: System Administrators', 'License :: OSI Approved :: BSD License', 'Natural Language :: English', 'Programming Language :: Python', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', 'Programming Language :: Python :: 3.6', 'Programming Language :: Python :: 3.7', 'Topic :: Communications :: File Sharing', ], ) <commit_msg>Add Webrecorder to short description<commit_after>
#!/usr/bin/env python from setuptools import setup with open('README.md', 'r') as readme_f: long_description = readme_f.read() setup( name='py-wasapi-client', version='1.1.0', url='https://github.com/unt-libraries/py-wasapi-client', author='University of North Texas Libraries', author_email='[email protected]', license='BSD', py_modules=['wasapi_client'], scripts=['wasapi_client.py'], description='A client for the Archive-It and Webrecorder WASAPI Data Transer API', long_description=long_description, long_description_content_type='text/markdown', install_requires=['requests>=2.18.1'], entry_points={ 'console_scripts': [ 'wasapi-client=wasapi_client:main' ] }, setup_requires=['pytest-runner'], tests_require=['pytest'], classifiers=[ 'Intended Audience :: System Administrators', 'License :: OSI Approved :: BSD License', 'Natural Language :: English', 'Programming Language :: Python', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', 'Programming Language :: Python :: 3.6', 'Programming Language :: Python :: 3.7', 'Topic :: Communications :: File Sharing', ], )
#!/usr/bin/env python from setuptools import setup with open('README.md', 'r') as readme_f: long_description = readme_f.read() setup( name='py-wasapi-client', version='1.1.0', url='https://github.com/unt-libraries/py-wasapi-client', author='University of North Texas Libraries', author_email='[email protected]', license='BSD', py_modules=['wasapi_client'], scripts=['wasapi_client.py'], description='A client for the [Archive-It] WASAPI Data Transer API', long_description=long_description, long_description_content_type='text/markdown', install_requires=['requests>=2.18.1'], entry_points={ 'console_scripts': [ 'wasapi-client=wasapi_client:main' ] }, setup_requires=['pytest-runner'], tests_require=['pytest'], classifiers=[ 'Intended Audience :: System Administrators', 'License :: OSI Approved :: BSD License', 'Natural Language :: English', 'Programming Language :: Python', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', 'Programming Language :: Python :: 3.6', 'Programming Language :: Python :: 3.7', 'Topic :: Communications :: File Sharing', ], ) Add Webrecorder to short description#!/usr/bin/env python from setuptools import setup with open('README.md', 'r') as readme_f: long_description = readme_f.read() setup( name='py-wasapi-client', version='1.1.0', url='https://github.com/unt-libraries/py-wasapi-client', author='University of North Texas Libraries', author_email='[email protected]', license='BSD', py_modules=['wasapi_client'], scripts=['wasapi_client.py'], description='A client for the Archive-It and Webrecorder WASAPI Data Transer API', long_description=long_description, long_description_content_type='text/markdown', install_requires=['requests>=2.18.1'], entry_points={ 'console_scripts': [ 'wasapi-client=wasapi_client:main' ] }, setup_requires=['pytest-runner'], tests_require=['pytest'], classifiers=[ 'Intended Audience :: System Administrators', 'License :: OSI Approved :: BSD License', 'Natural Language :: English', 'Programming Language :: Python', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', 'Programming Language :: Python :: 3.6', 'Programming Language :: Python :: 3.7', 'Topic :: Communications :: File Sharing', ], )
<commit_before>#!/usr/bin/env python from setuptools import setup with open('README.md', 'r') as readme_f: long_description = readme_f.read() setup( name='py-wasapi-client', version='1.1.0', url='https://github.com/unt-libraries/py-wasapi-client', author='University of North Texas Libraries', author_email='[email protected]', license='BSD', py_modules=['wasapi_client'], scripts=['wasapi_client.py'], description='A client for the [Archive-It] WASAPI Data Transer API', long_description=long_description, long_description_content_type='text/markdown', install_requires=['requests>=2.18.1'], entry_points={ 'console_scripts': [ 'wasapi-client=wasapi_client:main' ] }, setup_requires=['pytest-runner'], tests_require=['pytest'], classifiers=[ 'Intended Audience :: System Administrators', 'License :: OSI Approved :: BSD License', 'Natural Language :: English', 'Programming Language :: Python', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', 'Programming Language :: Python :: 3.6', 'Programming Language :: Python :: 3.7', 'Topic :: Communications :: File Sharing', ], ) <commit_msg>Add Webrecorder to short description<commit_after>#!/usr/bin/env python from setuptools import setup with open('README.md', 'r') as readme_f: long_description = readme_f.read() setup( name='py-wasapi-client', version='1.1.0', url='https://github.com/unt-libraries/py-wasapi-client', author='University of North Texas Libraries', author_email='[email protected]', license='BSD', py_modules=['wasapi_client'], scripts=['wasapi_client.py'], description='A client for the Archive-It and Webrecorder WASAPI Data Transer API', long_description=long_description, long_description_content_type='text/markdown', install_requires=['requests>=2.18.1'], entry_points={ 'console_scripts': [ 'wasapi-client=wasapi_client:main' ] }, setup_requires=['pytest-runner'], tests_require=['pytest'], classifiers=[ 'Intended Audience :: System Administrators', 'License :: OSI Approved :: BSD License', 'Natural Language :: English', 'Programming Language :: Python', 'Programming Language :: Python :: 3.4', 'Programming Language :: Python :: 3.5', 'Programming Language :: Python :: 3.6', 'Programming Language :: Python :: 3.7', 'Topic :: Communications :: File Sharing', ], )
ab8b6ed75f27820ce2711d597838584fe68e62ef
setup.py
setup.py
#!python import os from distutils.core import setup filepath = os.path.dirname(__file__) readme_file = os.path.join(filepath, 'README.md') try: import pypandoc long_description = pypandoc.convert(readme_file, 'rst') except(IOError, ImportError): long_description = open(readme_file).read() def extract_version(filename): import re pattern = re.compile(r'''__version__\s*=\s*"(?P<ver>[0-9\.]+)".*''') with file(filename, 'r') as fd: for line in fd: match = pattern.match(line) if match: ver = match.groupdict()['ver'] break else: raise Exception('ERROR: cannot find version string.') return ver version = extract_version('cmdlet/__init__.py') stage = '' setup( name = 'cmdlet', packages = ['cmdlet'], version = version, description = 'Cmdlet provides pipe-like mechanism to cascade functions and generators.', long_description=long_description, author = 'Gary Lee', author_email = '[email protected]', url = 'https://github.com/GaryLee/cmdlet', download_url = 'https://github.com/GaryLee/cmdlet/tarball/v%s%s' % (version, stage), keywords = ['pipe', 'generator', 'iterator'], classifiers = [], )
#!python import os from distutils.core import setup description = 'Cmdlet provides pipe-like mechanism to cascade functions and generators.' filepath = os.path.dirname(__file__) readme_file = os.path.join(filepath, 'README.md') if not os.path.exist(readme_file): long_description = description else: try: import pypandoc long_description = pypandoc.convert(readme_file, 'rst') except(IOError, ImportError): long_description = open(readme_file).read() def extract_version(filename): import re pattern = re.compile(r'''__version__\s*=\s*"(?P<ver>[0-9\.]+)".*''') with file(filename, 'r') as fd: for line in fd: match = pattern.match(line) if match: ver = match.groupdict()['ver'] break else: raise Exception('ERROR: cannot find version string.') return ver version = extract_version('cmdlet/__init__.py') stage = '' setup( name = 'cmdlet', packages = ['cmdlet'], version = version, description = description, long_description=long_description, author = 'Gary Lee', author_email = '[email protected]', url = 'https://github.com/GaryLee/cmdlet', download_url = 'https://github.com/GaryLee/cmdlet/tarball/v%s%s' % (version, stage), keywords = ['pipe', 'generator', 'iterator'], classifiers = [], )
Use short description if README.md not found.
Use short description if README.md not found.
Python
mit
GaryLee/cmdlet
#!python import os from distutils.core import setup filepath = os.path.dirname(__file__) readme_file = os.path.join(filepath, 'README.md') try: import pypandoc long_description = pypandoc.convert(readme_file, 'rst') except(IOError, ImportError): long_description = open(readme_file).read() def extract_version(filename): import re pattern = re.compile(r'''__version__\s*=\s*"(?P<ver>[0-9\.]+)".*''') with file(filename, 'r') as fd: for line in fd: match = pattern.match(line) if match: ver = match.groupdict()['ver'] break else: raise Exception('ERROR: cannot find version string.') return ver version = extract_version('cmdlet/__init__.py') stage = '' setup( name = 'cmdlet', packages = ['cmdlet'], version = version, description = 'Cmdlet provides pipe-like mechanism to cascade functions and generators.', long_description=long_description, author = 'Gary Lee', author_email = '[email protected]', url = 'https://github.com/GaryLee/cmdlet', download_url = 'https://github.com/GaryLee/cmdlet/tarball/v%s%s' % (version, stage), keywords = ['pipe', 'generator', 'iterator'], classifiers = [], ) Use short description if README.md not found.
#!python import os from distutils.core import setup description = 'Cmdlet provides pipe-like mechanism to cascade functions and generators.' filepath = os.path.dirname(__file__) readme_file = os.path.join(filepath, 'README.md') if not os.path.exist(readme_file): long_description = description else: try: import pypandoc long_description = pypandoc.convert(readme_file, 'rst') except(IOError, ImportError): long_description = open(readme_file).read() def extract_version(filename): import re pattern = re.compile(r'''__version__\s*=\s*"(?P<ver>[0-9\.]+)".*''') with file(filename, 'r') as fd: for line in fd: match = pattern.match(line) if match: ver = match.groupdict()['ver'] break else: raise Exception('ERROR: cannot find version string.') return ver version = extract_version('cmdlet/__init__.py') stage = '' setup( name = 'cmdlet', packages = ['cmdlet'], version = version, description = description, long_description=long_description, author = 'Gary Lee', author_email = '[email protected]', url = 'https://github.com/GaryLee/cmdlet', download_url = 'https://github.com/GaryLee/cmdlet/tarball/v%s%s' % (version, stage), keywords = ['pipe', 'generator', 'iterator'], classifiers = [], )
<commit_before>#!python import os from distutils.core import setup filepath = os.path.dirname(__file__) readme_file = os.path.join(filepath, 'README.md') try: import pypandoc long_description = pypandoc.convert(readme_file, 'rst') except(IOError, ImportError): long_description = open(readme_file).read() def extract_version(filename): import re pattern = re.compile(r'''__version__\s*=\s*"(?P<ver>[0-9\.]+)".*''') with file(filename, 'r') as fd: for line in fd: match = pattern.match(line) if match: ver = match.groupdict()['ver'] break else: raise Exception('ERROR: cannot find version string.') return ver version = extract_version('cmdlet/__init__.py') stage = '' setup( name = 'cmdlet', packages = ['cmdlet'], version = version, description = 'Cmdlet provides pipe-like mechanism to cascade functions and generators.', long_description=long_description, author = 'Gary Lee', author_email = '[email protected]', url = 'https://github.com/GaryLee/cmdlet', download_url = 'https://github.com/GaryLee/cmdlet/tarball/v%s%s' % (version, stage), keywords = ['pipe', 'generator', 'iterator'], classifiers = [], ) <commit_msg>Use short description if README.md not found.<commit_after>
#!python import os from distutils.core import setup description = 'Cmdlet provides pipe-like mechanism to cascade functions and generators.' filepath = os.path.dirname(__file__) readme_file = os.path.join(filepath, 'README.md') if not os.path.exist(readme_file): long_description = description else: try: import pypandoc long_description = pypandoc.convert(readme_file, 'rst') except(IOError, ImportError): long_description = open(readme_file).read() def extract_version(filename): import re pattern = re.compile(r'''__version__\s*=\s*"(?P<ver>[0-9\.]+)".*''') with file(filename, 'r') as fd: for line in fd: match = pattern.match(line) if match: ver = match.groupdict()['ver'] break else: raise Exception('ERROR: cannot find version string.') return ver version = extract_version('cmdlet/__init__.py') stage = '' setup( name = 'cmdlet', packages = ['cmdlet'], version = version, description = description, long_description=long_description, author = 'Gary Lee', author_email = '[email protected]', url = 'https://github.com/GaryLee/cmdlet', download_url = 'https://github.com/GaryLee/cmdlet/tarball/v%s%s' % (version, stage), keywords = ['pipe', 'generator', 'iterator'], classifiers = [], )
#!python import os from distutils.core import setup filepath = os.path.dirname(__file__) readme_file = os.path.join(filepath, 'README.md') try: import pypandoc long_description = pypandoc.convert(readme_file, 'rst') except(IOError, ImportError): long_description = open(readme_file).read() def extract_version(filename): import re pattern = re.compile(r'''__version__\s*=\s*"(?P<ver>[0-9\.]+)".*''') with file(filename, 'r') as fd: for line in fd: match = pattern.match(line) if match: ver = match.groupdict()['ver'] break else: raise Exception('ERROR: cannot find version string.') return ver version = extract_version('cmdlet/__init__.py') stage = '' setup( name = 'cmdlet', packages = ['cmdlet'], version = version, description = 'Cmdlet provides pipe-like mechanism to cascade functions and generators.', long_description=long_description, author = 'Gary Lee', author_email = '[email protected]', url = 'https://github.com/GaryLee/cmdlet', download_url = 'https://github.com/GaryLee/cmdlet/tarball/v%s%s' % (version, stage), keywords = ['pipe', 'generator', 'iterator'], classifiers = [], ) Use short description if README.md not found.#!python import os from distutils.core import setup description = 'Cmdlet provides pipe-like mechanism to cascade functions and generators.' filepath = os.path.dirname(__file__) readme_file = os.path.join(filepath, 'README.md') if not os.path.exist(readme_file): long_description = description else: try: import pypandoc long_description = pypandoc.convert(readme_file, 'rst') except(IOError, ImportError): long_description = open(readme_file).read() def extract_version(filename): import re pattern = re.compile(r'''__version__\s*=\s*"(?P<ver>[0-9\.]+)".*''') with file(filename, 'r') as fd: for line in fd: match = pattern.match(line) if match: ver = match.groupdict()['ver'] break else: raise Exception('ERROR: cannot find version string.') return ver version = extract_version('cmdlet/__init__.py') stage = '' setup( name = 'cmdlet', packages = ['cmdlet'], version = version, description = description, long_description=long_description, author = 'Gary Lee', author_email = '[email protected]', url = 'https://github.com/GaryLee/cmdlet', download_url = 'https://github.com/GaryLee/cmdlet/tarball/v%s%s' % (version, stage), keywords = ['pipe', 'generator', 'iterator'], classifiers = [], )
<commit_before>#!python import os from distutils.core import setup filepath = os.path.dirname(__file__) readme_file = os.path.join(filepath, 'README.md') try: import pypandoc long_description = pypandoc.convert(readme_file, 'rst') except(IOError, ImportError): long_description = open(readme_file).read() def extract_version(filename): import re pattern = re.compile(r'''__version__\s*=\s*"(?P<ver>[0-9\.]+)".*''') with file(filename, 'r') as fd: for line in fd: match = pattern.match(line) if match: ver = match.groupdict()['ver'] break else: raise Exception('ERROR: cannot find version string.') return ver version = extract_version('cmdlet/__init__.py') stage = '' setup( name = 'cmdlet', packages = ['cmdlet'], version = version, description = 'Cmdlet provides pipe-like mechanism to cascade functions and generators.', long_description=long_description, author = 'Gary Lee', author_email = '[email protected]', url = 'https://github.com/GaryLee/cmdlet', download_url = 'https://github.com/GaryLee/cmdlet/tarball/v%s%s' % (version, stage), keywords = ['pipe', 'generator', 'iterator'], classifiers = [], ) <commit_msg>Use short description if README.md not found.<commit_after>#!python import os from distutils.core import setup description = 'Cmdlet provides pipe-like mechanism to cascade functions and generators.' filepath = os.path.dirname(__file__) readme_file = os.path.join(filepath, 'README.md') if not os.path.exist(readme_file): long_description = description else: try: import pypandoc long_description = pypandoc.convert(readme_file, 'rst') except(IOError, ImportError): long_description = open(readme_file).read() def extract_version(filename): import re pattern = re.compile(r'''__version__\s*=\s*"(?P<ver>[0-9\.]+)".*''') with file(filename, 'r') as fd: for line in fd: match = pattern.match(line) if match: ver = match.groupdict()['ver'] break else: raise Exception('ERROR: cannot find version string.') return ver version = extract_version('cmdlet/__init__.py') stage = '' setup( name = 'cmdlet', packages = ['cmdlet'], version = version, description = description, long_description=long_description, author = 'Gary Lee', author_email = '[email protected]', url = 'https://github.com/GaryLee/cmdlet', download_url = 'https://github.com/GaryLee/cmdlet/tarball/v%s%s' % (version, stage), keywords = ['pipe', 'generator', 'iterator'], classifiers = [], )
d765eaa608ff1b12423d65c447a27d65eec38988
setup.py
setup.py
#!/usr/bin/python from setuptools import setup from distutils.extension import Extension from Pyrex.Distutils import build_ext setup( name="PyMoira", version="4.3.1", description="PyMoira - Python bindings for the Athena Moira library", author="Evan Broder", author_email="[email protected]", license="MIT", py_modules=['moira'], ext_modules=[ Extension("_moira", ["_moira.pyx"], libraries=["moira", "krb5"]), Extension("mrclient", ["mrclient.pyx"], libraries=["mrclient", "moira"]), ], scripts=['qy'], cmdclass= {"build_ext": build_ext} )
#!/usr/bin/python from setuptools import setup from distutils.extension import Extension from Pyrex.Distutils import build_ext setup( name="PyMoira", version="4.3.2", description="PyMoira - Python bindings for the Athena Moira library", author="Evan Broder", author_email="[email protected]", license="MIT", py_modules=['moira'], ext_modules=[ Extension("_moira", ["_moira.pyx"], libraries=["moira", "krb5"]), Extension("mrclient", ["mrclient.pyx"], libraries=["mrclient", "moira"]), ], cmdclass= {"build_ext": build_ext} )
Stop shipping qy with python-moira
Stop shipping qy with python-moira Moira now provides with its own native qy.
Python
mit
mit-athena/python-moira
#!/usr/bin/python from setuptools import setup from distutils.extension import Extension from Pyrex.Distutils import build_ext setup( name="PyMoira", version="4.3.1", description="PyMoira - Python bindings for the Athena Moira library", author="Evan Broder", author_email="[email protected]", license="MIT", py_modules=['moira'], ext_modules=[ Extension("_moira", ["_moira.pyx"], libraries=["moira", "krb5"]), Extension("mrclient", ["mrclient.pyx"], libraries=["mrclient", "moira"]), ], scripts=['qy'], cmdclass= {"build_ext": build_ext} ) Stop shipping qy with python-moira Moira now provides with its own native qy.
#!/usr/bin/python from setuptools import setup from distutils.extension import Extension from Pyrex.Distutils import build_ext setup( name="PyMoira", version="4.3.2", description="PyMoira - Python bindings for the Athena Moira library", author="Evan Broder", author_email="[email protected]", license="MIT", py_modules=['moira'], ext_modules=[ Extension("_moira", ["_moira.pyx"], libraries=["moira", "krb5"]), Extension("mrclient", ["mrclient.pyx"], libraries=["mrclient", "moira"]), ], cmdclass= {"build_ext": build_ext} )
<commit_before>#!/usr/bin/python from setuptools import setup from distutils.extension import Extension from Pyrex.Distutils import build_ext setup( name="PyMoira", version="4.3.1", description="PyMoira - Python bindings for the Athena Moira library", author="Evan Broder", author_email="[email protected]", license="MIT", py_modules=['moira'], ext_modules=[ Extension("_moira", ["_moira.pyx"], libraries=["moira", "krb5"]), Extension("mrclient", ["mrclient.pyx"], libraries=["mrclient", "moira"]), ], scripts=['qy'], cmdclass= {"build_ext": build_ext} ) <commit_msg>Stop shipping qy with python-moira Moira now provides with its own native qy.<commit_after>
#!/usr/bin/python from setuptools import setup from distutils.extension import Extension from Pyrex.Distutils import build_ext setup( name="PyMoira", version="4.3.2", description="PyMoira - Python bindings for the Athena Moira library", author="Evan Broder", author_email="[email protected]", license="MIT", py_modules=['moira'], ext_modules=[ Extension("_moira", ["_moira.pyx"], libraries=["moira", "krb5"]), Extension("mrclient", ["mrclient.pyx"], libraries=["mrclient", "moira"]), ], cmdclass= {"build_ext": build_ext} )
#!/usr/bin/python from setuptools import setup from distutils.extension import Extension from Pyrex.Distutils import build_ext setup( name="PyMoira", version="4.3.1", description="PyMoira - Python bindings for the Athena Moira library", author="Evan Broder", author_email="[email protected]", license="MIT", py_modules=['moira'], ext_modules=[ Extension("_moira", ["_moira.pyx"], libraries=["moira", "krb5"]), Extension("mrclient", ["mrclient.pyx"], libraries=["mrclient", "moira"]), ], scripts=['qy'], cmdclass= {"build_ext": build_ext} ) Stop shipping qy with python-moira Moira now provides with its own native qy.#!/usr/bin/python from setuptools import setup from distutils.extension import Extension from Pyrex.Distutils import build_ext setup( name="PyMoira", version="4.3.2", description="PyMoira - Python bindings for the Athena Moira library", author="Evan Broder", author_email="[email protected]", license="MIT", py_modules=['moira'], ext_modules=[ Extension("_moira", ["_moira.pyx"], libraries=["moira", "krb5"]), Extension("mrclient", ["mrclient.pyx"], libraries=["mrclient", "moira"]), ], cmdclass= {"build_ext": build_ext} )
<commit_before>#!/usr/bin/python from setuptools import setup from distutils.extension import Extension from Pyrex.Distutils import build_ext setup( name="PyMoira", version="4.3.1", description="PyMoira - Python bindings for the Athena Moira library", author="Evan Broder", author_email="[email protected]", license="MIT", py_modules=['moira'], ext_modules=[ Extension("_moira", ["_moira.pyx"], libraries=["moira", "krb5"]), Extension("mrclient", ["mrclient.pyx"], libraries=["mrclient", "moira"]), ], scripts=['qy'], cmdclass= {"build_ext": build_ext} ) <commit_msg>Stop shipping qy with python-moira Moira now provides with its own native qy.<commit_after>#!/usr/bin/python from setuptools import setup from distutils.extension import Extension from Pyrex.Distutils import build_ext setup( name="PyMoira", version="4.3.2", description="PyMoira - Python bindings for the Athena Moira library", author="Evan Broder", author_email="[email protected]", license="MIT", py_modules=['moira'], ext_modules=[ Extension("_moira", ["_moira.pyx"], libraries=["moira", "krb5"]), Extension("mrclient", ["mrclient.pyx"], libraries=["mrclient", "moira"]), ], cmdclass= {"build_ext": build_ext} )
f4d33519c9ed78887de8040c865e94d6b0430077
setup.py
setup.py
from setuptools import setup, find_packages version = '1.3.5' setup(name='switchboard', version=version, description="Feature flipper for Pyramid, Pylons, or TurboGears apps.", # http://www.python.org/pypi?%3Aaction=list_classifiers classifiers=[ "Programming Language :: Python", "Topic :: Software Development :: Libraries :: Python Modules", ], keywords='switches feature flipper pyramid pylons turbogears', author='Kyle Adams', author_email='[email protected]', url='https://github.com/switchboardpy/switchboard/', download_url='https://github.com/switchboardpy/switchboard/releases', license='Apache License', packages=find_packages(exclude=['ez_setup']), include_package_data=True, install_requires=[ 'pymongo == 2.3', 'blinker >= 1.2', 'WebOb >= 0.9', 'Mako >= 0.9', 'bottle == 0.12.8', ], zip_safe=False, tests_require=[ 'nose', 'mock', 'paste', 'selenium', 'splinter', ], test_suite='nose.collector', )
from setuptools import setup, find_packages version = '1.3.5' setup(name='switchboard', version=version, description="Feature flipper for Pyramid, Pylons, or TurboGears apps.", # http://www.python.org/pypi?%3Aaction=list_classifiers classifiers=[ "Programming Language :: Python", "Topic :: Software Development :: Libraries :: Python Modules", ], keywords='switches feature flipper pyramid pylons turbogears', author='Kyle Adams', author_email='[email protected]', url='https://github.com/switchboardpy/switchboard/', download_url='https://github.com/switchboardpy/switchboard/releases', license='Apache License', packages=find_packages(exclude=['ez_setup']), include_package_data=True, install_requires=[ 'pymongo >= 2.3, < 3', 'blinker >= 1.2', 'WebOb >= 0.9', 'Mako >= 0.9', 'bottle == 0.12.8', ], zip_safe=False, tests_require=[ 'nose', 'mock', 'paste', 'selenium', 'splinter', ], test_suite='nose.collector', )
Allow any pymongo 2.x version
Allow any pymongo 2.x version
Python
apache-2.0
kadams54/switchboard,switchboardpy/switchboard
from setuptools import setup, find_packages version = '1.3.5' setup(name='switchboard', version=version, description="Feature flipper for Pyramid, Pylons, or TurboGears apps.", # http://www.python.org/pypi?%3Aaction=list_classifiers classifiers=[ "Programming Language :: Python", "Topic :: Software Development :: Libraries :: Python Modules", ], keywords='switches feature flipper pyramid pylons turbogears', author='Kyle Adams', author_email='[email protected]', url='https://github.com/switchboardpy/switchboard/', download_url='https://github.com/switchboardpy/switchboard/releases', license='Apache License', packages=find_packages(exclude=['ez_setup']), include_package_data=True, install_requires=[ 'pymongo == 2.3', 'blinker >= 1.2', 'WebOb >= 0.9', 'Mako >= 0.9', 'bottle == 0.12.8', ], zip_safe=False, tests_require=[ 'nose', 'mock', 'paste', 'selenium', 'splinter', ], test_suite='nose.collector', ) Allow any pymongo 2.x version
from setuptools import setup, find_packages version = '1.3.5' setup(name='switchboard', version=version, description="Feature flipper for Pyramid, Pylons, or TurboGears apps.", # http://www.python.org/pypi?%3Aaction=list_classifiers classifiers=[ "Programming Language :: Python", "Topic :: Software Development :: Libraries :: Python Modules", ], keywords='switches feature flipper pyramid pylons turbogears', author='Kyle Adams', author_email='[email protected]', url='https://github.com/switchboardpy/switchboard/', download_url='https://github.com/switchboardpy/switchboard/releases', license='Apache License', packages=find_packages(exclude=['ez_setup']), include_package_data=True, install_requires=[ 'pymongo >= 2.3, < 3', 'blinker >= 1.2', 'WebOb >= 0.9', 'Mako >= 0.9', 'bottle == 0.12.8', ], zip_safe=False, tests_require=[ 'nose', 'mock', 'paste', 'selenium', 'splinter', ], test_suite='nose.collector', )
<commit_before>from setuptools import setup, find_packages version = '1.3.5' setup(name='switchboard', version=version, description="Feature flipper for Pyramid, Pylons, or TurboGears apps.", # http://www.python.org/pypi?%3Aaction=list_classifiers classifiers=[ "Programming Language :: Python", "Topic :: Software Development :: Libraries :: Python Modules", ], keywords='switches feature flipper pyramid pylons turbogears', author='Kyle Adams', author_email='[email protected]', url='https://github.com/switchboardpy/switchboard/', download_url='https://github.com/switchboardpy/switchboard/releases', license='Apache License', packages=find_packages(exclude=['ez_setup']), include_package_data=True, install_requires=[ 'pymongo == 2.3', 'blinker >= 1.2', 'WebOb >= 0.9', 'Mako >= 0.9', 'bottle == 0.12.8', ], zip_safe=False, tests_require=[ 'nose', 'mock', 'paste', 'selenium', 'splinter', ], test_suite='nose.collector', ) <commit_msg>Allow any pymongo 2.x version<commit_after>
from setuptools import setup, find_packages version = '1.3.5' setup(name='switchboard', version=version, description="Feature flipper for Pyramid, Pylons, or TurboGears apps.", # http://www.python.org/pypi?%3Aaction=list_classifiers classifiers=[ "Programming Language :: Python", "Topic :: Software Development :: Libraries :: Python Modules", ], keywords='switches feature flipper pyramid pylons turbogears', author='Kyle Adams', author_email='[email protected]', url='https://github.com/switchboardpy/switchboard/', download_url='https://github.com/switchboardpy/switchboard/releases', license='Apache License', packages=find_packages(exclude=['ez_setup']), include_package_data=True, install_requires=[ 'pymongo >= 2.3, < 3', 'blinker >= 1.2', 'WebOb >= 0.9', 'Mako >= 0.9', 'bottle == 0.12.8', ], zip_safe=False, tests_require=[ 'nose', 'mock', 'paste', 'selenium', 'splinter', ], test_suite='nose.collector', )
from setuptools import setup, find_packages version = '1.3.5' setup(name='switchboard', version=version, description="Feature flipper for Pyramid, Pylons, or TurboGears apps.", # http://www.python.org/pypi?%3Aaction=list_classifiers classifiers=[ "Programming Language :: Python", "Topic :: Software Development :: Libraries :: Python Modules", ], keywords='switches feature flipper pyramid pylons turbogears', author='Kyle Adams', author_email='[email protected]', url='https://github.com/switchboardpy/switchboard/', download_url='https://github.com/switchboardpy/switchboard/releases', license='Apache License', packages=find_packages(exclude=['ez_setup']), include_package_data=True, install_requires=[ 'pymongo == 2.3', 'blinker >= 1.2', 'WebOb >= 0.9', 'Mako >= 0.9', 'bottle == 0.12.8', ], zip_safe=False, tests_require=[ 'nose', 'mock', 'paste', 'selenium', 'splinter', ], test_suite='nose.collector', ) Allow any pymongo 2.x versionfrom setuptools import setup, find_packages version = '1.3.5' setup(name='switchboard', version=version, description="Feature flipper for Pyramid, Pylons, or TurboGears apps.", # http://www.python.org/pypi?%3Aaction=list_classifiers classifiers=[ "Programming Language :: Python", "Topic :: Software Development :: Libraries :: Python Modules", ], keywords='switches feature flipper pyramid pylons turbogears', author='Kyle Adams', author_email='[email protected]', url='https://github.com/switchboardpy/switchboard/', download_url='https://github.com/switchboardpy/switchboard/releases', license='Apache License', packages=find_packages(exclude=['ez_setup']), include_package_data=True, install_requires=[ 'pymongo >= 2.3, < 3', 'blinker >= 1.2', 'WebOb >= 0.9', 'Mako >= 0.9', 'bottle == 0.12.8', ], zip_safe=False, tests_require=[ 'nose', 'mock', 'paste', 'selenium', 'splinter', ], test_suite='nose.collector', )
<commit_before>from setuptools import setup, find_packages version = '1.3.5' setup(name='switchboard', version=version, description="Feature flipper for Pyramid, Pylons, or TurboGears apps.", # http://www.python.org/pypi?%3Aaction=list_classifiers classifiers=[ "Programming Language :: Python", "Topic :: Software Development :: Libraries :: Python Modules", ], keywords='switches feature flipper pyramid pylons turbogears', author='Kyle Adams', author_email='[email protected]', url='https://github.com/switchboardpy/switchboard/', download_url='https://github.com/switchboardpy/switchboard/releases', license='Apache License', packages=find_packages(exclude=['ez_setup']), include_package_data=True, install_requires=[ 'pymongo == 2.3', 'blinker >= 1.2', 'WebOb >= 0.9', 'Mako >= 0.9', 'bottle == 0.12.8', ], zip_safe=False, tests_require=[ 'nose', 'mock', 'paste', 'selenium', 'splinter', ], test_suite='nose.collector', ) <commit_msg>Allow any pymongo 2.x version<commit_after>from setuptools import setup, find_packages version = '1.3.5' setup(name='switchboard', version=version, description="Feature flipper for Pyramid, Pylons, or TurboGears apps.", # http://www.python.org/pypi?%3Aaction=list_classifiers classifiers=[ "Programming Language :: Python", "Topic :: Software Development :: Libraries :: Python Modules", ], keywords='switches feature flipper pyramid pylons turbogears', author='Kyle Adams', author_email='[email protected]', url='https://github.com/switchboardpy/switchboard/', download_url='https://github.com/switchboardpy/switchboard/releases', license='Apache License', packages=find_packages(exclude=['ez_setup']), include_package_data=True, install_requires=[ 'pymongo >= 2.3, < 3', 'blinker >= 1.2', 'WebOb >= 0.9', 'Mako >= 0.9', 'bottle == 0.12.8', ], zip_safe=False, tests_require=[ 'nose', 'mock', 'paste', 'selenium', 'splinter', ], test_suite='nose.collector', )
706dbcc5208cdebe616e387b280aa7411d4bdc42
setup.py
setup.py
# coding: utf-8 from setuptools import setup, find_packages setup( name = 'thumbor_aws', version = "1", description = 'Thumbor AWS extensions', author = 'William King', author_email = '[email protected]', zip_safe = False, include_package_data = True, packages=find_packages(), install_requires=['py-dateutil','thumbor','boto'] )
# coding: utf-8 from setuptools import setup, find_packages setup( name = 'thumbor_aws', version = "1", description = 'Thumbor AWS extensions', author = 'William King', author_email = '[email protected]', zip_safe = False, include_package_data = True, packages=find_packages(), install_requires=['python-dateutil','thumbor','boto'] )
Use python-dateutil instead of py-dateutil
Use python-dateutil instead of py-dateutil
Python
mit
voxmedia/aws,bob3000/thumbor_aws,pgr0ss/aws,andrew-a-dev/aws,aoqfonseca/aws,tsauzeau/aws,thumbor-community/aws,guilhermef/aws,ScrunchEnterprises/thumbor_aws,abaldwin1/tc_aws
# coding: utf-8 from setuptools import setup, find_packages setup( name = 'thumbor_aws', version = "1", description = 'Thumbor AWS extensions', author = 'William King', author_email = '[email protected]', zip_safe = False, include_package_data = True, packages=find_packages(), install_requires=['py-dateutil','thumbor','boto'] ) Use python-dateutil instead of py-dateutil
# coding: utf-8 from setuptools import setup, find_packages setup( name = 'thumbor_aws', version = "1", description = 'Thumbor AWS extensions', author = 'William King', author_email = '[email protected]', zip_safe = False, include_package_data = True, packages=find_packages(), install_requires=['python-dateutil','thumbor','boto'] )
<commit_before># coding: utf-8 from setuptools import setup, find_packages setup( name = 'thumbor_aws', version = "1", description = 'Thumbor AWS extensions', author = 'William King', author_email = '[email protected]', zip_safe = False, include_package_data = True, packages=find_packages(), install_requires=['py-dateutil','thumbor','boto'] ) <commit_msg>Use python-dateutil instead of py-dateutil<commit_after>
# coding: utf-8 from setuptools import setup, find_packages setup( name = 'thumbor_aws', version = "1", description = 'Thumbor AWS extensions', author = 'William King', author_email = '[email protected]', zip_safe = False, include_package_data = True, packages=find_packages(), install_requires=['python-dateutil','thumbor','boto'] )
# coding: utf-8 from setuptools import setup, find_packages setup( name = 'thumbor_aws', version = "1", description = 'Thumbor AWS extensions', author = 'William King', author_email = '[email protected]', zip_safe = False, include_package_data = True, packages=find_packages(), install_requires=['py-dateutil','thumbor','boto'] ) Use python-dateutil instead of py-dateutil# coding: utf-8 from setuptools import setup, find_packages setup( name = 'thumbor_aws', version = "1", description = 'Thumbor AWS extensions', author = 'William King', author_email = '[email protected]', zip_safe = False, include_package_data = True, packages=find_packages(), install_requires=['python-dateutil','thumbor','boto'] )
<commit_before># coding: utf-8 from setuptools import setup, find_packages setup( name = 'thumbor_aws', version = "1", description = 'Thumbor AWS extensions', author = 'William King', author_email = '[email protected]', zip_safe = False, include_package_data = True, packages=find_packages(), install_requires=['py-dateutil','thumbor','boto'] ) <commit_msg>Use python-dateutil instead of py-dateutil<commit_after># coding: utf-8 from setuptools import setup, find_packages setup( name = 'thumbor_aws', version = "1", description = 'Thumbor AWS extensions', author = 'William King', author_email = '[email protected]', zip_safe = False, include_package_data = True, packages=find_packages(), install_requires=['python-dateutil','thumbor','boto'] )