Dataset Viewer
Auto-converted to Parquet Duplicate
name
stringlengths
8
12
seq
stringlengths
20
4.91k
tertiary
sequencelengths
20
4.91k
valid_mask
sequencelengths
20
4.91k
metadata
dict
2LQX_1_A
SEKPQQELEECQNVCRMKRWSTEMVHRCEKKCEEKFERQQR
[ [ 2.0939998626708984, 0.0020000000949949026, -1.2419999837875366 ], [ 5.125999927520752, -2.0210001468658447, -2.3289999961853027 ], [ 7.5229997634887695, 0.6150000095367432, -3.6610000133514404 ], [ 9.757999420166016, 2.7279999256134033, -1.38199996948242...
[ true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true...
{ "contact_density": 0.018292682926829267, "has_valid_structure": true, "invalid_residues": 0, "long_range_contacts": 3, "medium_range_contacts": 8, "seq_length": 41, "short_range_contacts": 4, "token_count": 41, "tokenization_ratio": 1, "total_contacts": 15, "valid_residues": 41 }
3NQO_1_A
GMDYSNELKELFLMNQTYATLFTLTNKIQIEGDKYFGILTSRQYMTILSILHLPEEETTLNNIARKMGTSKQNINRLVANLEKNGYVDVIPSPHDKRAINVKVTDLGKKVMVTCSRTGINFMADVFHEFTKDELETLWSLLKKMYRFNGEEQDGFEEDANFMEYEEIDKIKSEALEEFAKRRNRVNKND
[ [ 0, 0, 0 ], [ 0, 0, 0 ], [ 101.96599578857422, 41.57899856567383, 51.1150016784668 ], [ 98.26000213623047, 40.77000045776367, 51.13999938964844 ], [ 99.01799774169922, 37.209999084472656, 52.253997802734375 ], [ 97.36499786376953, ...
[ false, false, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, tr...
{ "contact_density": 0.007771234290571307, "has_valid_structure": true, "invalid_residues": 7, "long_range_contacts": 61, "medium_range_contacts": 32, "seq_length": 189, "short_range_contacts": 35, "token_count": 189, "tokenization_ratio": 1, "total_contacts": 128, "valid_residues": 182 }
4XG0_1_A
MHHHHHHSSGVDLGTENLYFQSMGGPYIGIVADDLTGSGDTAVQFVRAGWATQLSVGGAEQALADPAVRQAEVLAVTTHSRPLAAADAAAVVRGEVERLRAAGVQRLYKKVDSTLRGAFKAEIDAARLAWGEDAIAVVCPAFPVTGRTVRQGVLYVGDRPVTETSAATDPVTPVTESHIPTLLGCAQLAAQAGETPAELARRIAAAAPVVVVDALDDADVQRLARAIGVLGQRAVPVGSGGLAAPLARVWAGGQAAGPVLVVVTSQHSAARQQAAALQQAGARTWAPTLAQLADDRNWAAWTAEVEAAEHGMPAVDALMLLAPEGRLAGLDADSVARRLGELAARLVLAHGAAGVVATGGDGASAVLAALQASGIALVDEVTGGVPLGTLTGGQAAGLPVVTKAGGFGEQDVLIRAAQAIRERRFTK
[ [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ],...
[ false, false, false, false, false, false, false, false, false, false, false, false, false, false, false, false, false, false, false, false, false, false, false, true, true, true, true, true, true, true, true, true, true, true, true, true, true,...
{ "contact_density": 0.011268629589240277, "has_valid_structure": true, "invalid_residues": 34, "long_range_contacts": 617, "medium_range_contacts": 139, "seq_length": 427, "short_range_contacts": 112, "token_count": 427, "tokenization_ratio": 1, "total_contacts": 868, "valid_residues": 393 }
2ROD_2_B
AELPPEFAAQLRKIGDKVYCTWSAPDM
[ [ 22.581998825073242, -20.351999282836914, 13.699000358581543 ], [ 20.250999450683594, -17.534000396728516, 14.845000267028809 ], [ 19.195999145507812, -13.970999717712402, 13.983000755310059 ], [ 20.009000778198242, -11.539999961853027, 16.847000122070312...
[ true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true ]
{ "contact_density": 0, "has_valid_structure": true, "invalid_residues": 0, "long_range_contacts": 0, "medium_range_contacts": 0, "seq_length": 27, "short_range_contacts": 0, "token_count": 27, "tokenization_ratio": 1, "total_contacts": 0, "valid_residues": 27 }
3W4T_1_A
MSEKTTKGVQLLRGDPKKAIVRLSIAMMIGMSVQTLYNLADGIWVSGLGPESLAAVGLFFPVFMGIIALAAGLGVGTSSAIARRIGARDKEGADNVAVHSLILSLILGVTITITMLPAIDSLFRSMGAKGEAVELAIEYARVLLAGAFIIVFNNVGNGILRGEGDANRAMLAMVLGSGLNIVLDPIFIYTLGFGVVGAAYATLLSMVVTSLFIAYWLFVKRDTYVDITLRDFSPSREILKDILRVGLPSSLSQLSMSIAMFFLNSVAITAGGENGVAVFTSAWRITMLGIVPILGMAAATTSVTGAAYGERNVEKLETAYLYAIKIAFMIELAVVAFIMLFAPQVAYLFTYSESAQVIKGDLISALRTLPVFLVLTPFGMMTSAMFQGIGEGEKSLILTIFRTLVMQVGFAYIFVHYTTLGLRGVWIGIVIGNMVAAIVGFLWGRMRISALKKTSATGGKR
[ [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ -57.36399841308594, 0.3070000112056732, 24.81999969482422 ], [ -54.61600112915039, -2.322000026702881, 24.665000915527344 ], [ -52.79999923706055, -4.016000270843506, 21.7839984893798...
[ false, false, false, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, t...
{ "contact_density": 0.006963269007910515, "has_valid_structure": true, "invalid_residues": 15, "long_range_contacts": 553, "medium_range_contacts": 73, "seq_length": 461, "short_range_contacts": 65, "token_count": 461, "tokenization_ratio": 1, "total_contacts": 691, "valid_residues": 446 }
1GAI_1_A
ATLDSWLSNEATVARTAILNNIGADGAWVSGADSGIVVASPSTDNPDYFYTWTRDSGLVIKTLVDLFRNGDTDLLSTIEHYISSQAIIQGVSNPSGDLSSGGLGEPKFNVDETAYTGSWGRPQRDGPALRATAMIGFGQWLLDNGYTSAATEIVWPLVRNDLSYVAQYWNQTGYDLWEEVNGSSFFTIAVQHRALVEGSAFATAVGSSCSWCDSQAPQILCYLQSFWTGSYILANFDSSRSGKDTNTLLGSIHTFDPEAGCDDSTFQPCSPRALANHKEVVDSFRSIYTLNDGLSDSEAVAVGRYPEDSYYNGNPWFLCTLAAAEQLYDALYQWDKQGSLEITDVSLDFFKALYSGAATGTYSSSSSTYSSIVSAVKTFADGFVSIVETHAASNGSLSEQFDKSDGDELSARDLTWSYAALLTANNRRNSVVPPSWGETSASSVPGTCAATSASGTYSSVTVTSWPSIVATG
[ [ 49.14200210571289, 47.371002197265625, 20.378999710083008 ], [ 46.06700134277344, 47.257999420166016, 18.145000457763672 ], [ 46.132999420166016, 43.444000244140625, 18.243999481201172 ], [ 45.70399856567383, 43.567996978759766, 22.023000717163086 ], ...
[ true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true...
{ "contact_density": 0.00824966713447767, "has_valid_structure": true, "invalid_residues": 0, "long_range_contacts": 560, "medium_range_contacts": 178, "seq_length": 472, "short_range_contacts": 179, "token_count": 472, "tokenization_ratio": 1, "total_contacts": 917, "valid_residues": 472 }
4MH6_1_A
MHHHHHHSSGVDLGTENLYFQSNAMIERLLEIKKIRADRADKAVQRQEYRVANVAAELQKAERSVADYHVWRQEEEERRFAKAKQQTVLLKELETLRQEIALLREREAELKQRVAEVKVTLEQERTLLKQKQQEALQAHKTKEKFVQLQQQEIAEQSRQQQYQEELEQEEFRTVDII
[ [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ],...
[ false, false, false, false, false, false, false, false, false, false, false, false, false, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, ...
{ "contact_density": 0.006209696680200621, "has_valid_structure": true, "invalid_residues": 18, "long_range_contacts": 72, "medium_range_contacts": 5, "seq_length": 177, "short_range_contacts": 1, "token_count": 177, "tokenization_ratio": 1, "total_contacts": 78, "valid_residues": 159 }
4TU8_1_A
GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRAS
[ [ -27.233999252319336, -19.724000930786133, 17.95599937438965 ], [ -28.8700008392334, -18.208999633789062, 21.072999954223633 ], [ -27.59600067138672, -20.9689998626709, 23.391000747680664 ], [ -24.128999710083008, -21.358999252319336, 21.8700008392334 ]...
[ true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true...
{ "contact_density": 0.01913494119992027, "has_valid_structure": true, "invalid_residues": 0, "long_range_contacts": 171, "medium_range_contacts": 64, "seq_length": 174, "short_range_contacts": 53, "token_count": 174, "tokenization_ratio": 1, "total_contacts": 288, "valid_residues": 174 }
4LQZ_1_A
MGSDKIHHHHHHENLYFQGQRFEIQQHNETIGSIYFSADYAHIRGIEKGTAKYFIDKVGSKRYLFIEYIPDNVLNCKPDFWKTLKYKKDKVTYYVYLIENLDDEVFHLSALQDMNRIPIDIADDVATMGKSPHQNDRMTLKLNKNN
[ [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ],...
[ false, false, false, false, false, false, false, false, false, false, false, false, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, ...
{ "contact_density": 0.03464474456840869, "has_valid_structure": true, "invalid_residues": 15, "long_range_contacts": 150, "medium_range_contacts": 73, "seq_length": 146, "short_range_contacts": 72, "token_count": 146, "tokenization_ratio": 1, "total_contacts": 295, "valid_residues": 131 }
1G1T_1_A
WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIV
[ [ 46.4170036315918, 88.91900634765625, 33.06700134277344 ], [ 46.33799743652344, 89.9540023803711, 36.729000091552734 ], [ 45.840999603271484, 93.40499877929688, 38.24100112915039 ], [ 47.7140007019043, 95.61799621582031, 40.70500183105469 ], [ 47....
[ true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true...
{ "contact_density": 0.026947574718275354, "has_valid_structure": true, "invalid_residues": 0, "long_range_contacts": 201, "medium_range_contacts": 52, "seq_length": 157, "short_range_contacts": 77, "token_count": 157, "tokenization_ratio": 1, "total_contacts": 330, "valid_residues": 157 }
1EWF_1_A
VNPGVVVRISQKGLDYASQQGTAALQKELKRIKIPDYSDSFKIKHLGKGHYSFYSMDIREFQLPSSQISMVPNVGLKFSISNANIKISGKWKAQKRFLKMSGNFDLSIEGMSISADLKLGSNPTSGKPTITCSSCSSHINSVHVHISKSKVGWLIQLFHKKIESALRNKMNSQVCEKVTNSVSSELQPYFQTLPVMTKIDSVAGINYGLVAPPATTAETLDVQMKGEFYSENHHNPPPFAPPVMEFPAAHDRMVYLGLSDYFFNTAGLVYQEAGVLKMTLRDDMIPKESKFRLTTKFFGTFLPEVAKKFPNMKIQIHVSASTPPHLSVQPTGLTFYPAVDVQAFAVLPNSALASLFLIGMHTTGSMEVSAESNRLVGELKLDRLLLELKHSNIGPFPVELLQDIMNYIVPILVLPRVNEKLQKGFPLPTPARVQLYNVVLQPHQNFLLFGADVVYK
[ [ 98.69400024414062, 12.67699909210205, 13.729000091552734 ], [ 95.95099639892578, 15.329000473022461, 14.04699993133545 ], [ 97.02599334716797, 18.145000457763672, 16.319000244140625 ], [ 94.71299743652344, 20.8799991607666, 17.660999298095703 ], [ ...
[ true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true...
{ "contact_density": 0.009417775207248891, "has_valid_structure": true, "invalid_residues": 0, "long_range_contacts": 607, "medium_range_contacts": 236, "seq_length": 456, "short_range_contacts": 134, "token_count": 456, "tokenization_ratio": 1, "total_contacts": 977, "valid_residues": 456 }
4AYB_9_K
MGLERDGILSQDLHFNEVFVSLWQNKLTRYEIARVISARALQLAMGAPALIDINNISSTDVISIAEEEFKRGVLPITIRRRLPNGKIILLSLRKS
[ [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ 0, 0, 0 ], [ -23.236000061035156,...
[ false, false, false, false, false, false, false, false, false, false, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, tr...
{ "contact_density": 0.01721170395869191, "has_valid_structure": true, "invalid_residues": 11, "long_range_contacts": 11, "medium_range_contacts": 34, "seq_length": 95, "short_range_contacts": 15, "token_count": 95, "tokenization_ratio": 1, "total_contacts": 60, "valid_residues": 84 }
3DTN_1_A
MSLSEIKRKFDAVSGKYDEQRRKFIPCFDDFYGVSVSIASVDTENPDILDLGAGTGLLSAFLMEKYPEATFTLVDMSEKMLEIAKNRFRGNLKVKYIEADYSKYDFEEKYDMVVSALSIHHLEDEDKKELYKRSYSILKESGIFINADLVHGETAFIENLNKTIWRQYVENSGLTEEEIAAGYERSKLDKDIEMNQQLNWLKEAGFRDVSCIYKYYQFAVMFGRKTEGHHHHHH
[ [ 0, 0, 0 ], [ 0, 0, 0 ], [ 5.275000095367432, 2.8350000381469727, -1.906000018119812 ], [ 7.02400016784668, 6.164000034332275, -2.443000078201294 ], [ 6.380999565124512, 7.854000091552734, -5.73799991607666 ], [ 9.840999603271484, ...
[ false, false, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, true, tr...
{ "contact_density": 0.015400581154005812, "has_valid_structure": true, "invalid_residues": 14, "long_range_contacts": 262, "medium_range_contacts": 73, "seq_length": 234, "short_range_contacts": 36, "token_count": 234, "tokenization_ratio": 1, "total_contacts": 371, "valid_residues": 220 }
End of preview. Expand in Data Studio

Background

What is Protein Contact Prediction?

Protein contact prediction is a fundamental task in computational biology that aims to predict which amino acid residues in a protein sequence are in close spatial proximity (typically within 8Å) in the protein's 3D structure. This information is crucial for:

  • Protein structure prediction
  • Understanding protein folding mechanisms
  • Drug discovery and design
  • Evolutionary analysis

Linear Probing for Protein Language Models

Linear probing is a technique used to evaluate the quality of learned representations from pre-trained language models. In the context of protein language models (PLMs):

  1. Freeze the pre-trained model parameters
  2. Train only a simple linear classifier on top of the frozen embeddings
  3. Evaluate how well the linear classifier performs on downstream tasks

This approach helps assess the quality of protein representations learned by different PLMs without the confounding effects of fine-tuning the entire model.

Task Definition

Contact Map Generation

Parameter Value Description
Distance Threshold 8.0 Å Distance between Cα atoms
Sequence Separation ≥ 6 residues Minimum separation (|i-j| ≥ 6)
Valid Contacts Required Only consider residues with valid 3D coordinates

Evaluation Metrics

The evaluation follows standard contact prediction protocols with precision at different coverage levels:

Range Categories

Range Separation Description
Short Range 6 ≤ |i-j| ≤ 11 Local contacts
Medium Range 12 ≤ |i-j| ≤ 23 Medium-distance contacts
Long Range |i-j| ≥ 24 Long-distance contacts

Precision Metrics

  • P@L: Precision at top L contacts (L = sequence length)
  • P@L/2: Precision at top L/2 contacts
  • P@L/5: Precision at top L/5 contacts

Each metric is calculated separately for each range category, resulting in 9 total metrics per evaluation.

Dataset Format

The system uses HuggingFace datasets with entries containing:

{
    "seq": "MKTFFVLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFL",
    "tertiary": [[x1,y1,z1], [x2,y2,z2], ...],
    "valid_mask": [true, true, false, ...]
}

Default Dataset: fredzzp/contact_data (automatically downloaded from HuggingFace Hub)

Downloads last month
7